Clone IP10440 Report

Search the DGRC for IP10440

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:104
Well:40
Vector:pOT2
Associated Gene/TranscriptCG12917-RB
Protein status:IP10440.pep: gold
Preliminary Size:963
Sequenced Size:1507

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12917 2005-01-01 Successful iPCR screen
CG12917 2008-04-29 Release 5.5 accounting
CG12917 2008-08-15 Release 5.9 accounting
CG12917 2008-12-18 5.12 accounting

Clone Sequence Records

IP10440.complete Sequence

1507 bp (1507 high quality bases) assembled on 2005-03-24

GenBank Submission: BT023395

> IP10440.complete
AATAGGTTCCGAAATTTGCTTCCGAAATGGCTTCTATAAAATAGTATGTT
GAACTAACTGCTAACTAGAATGTATCGATAGAAGCTTCCGATTTAGGAAT
TTAGTACATTTAACTTCTTTATTTGGCATTTTTTCAAAATTTTCATAGTA
TATGAAAATTGCTCCTATGGATTGCTCCTATATCACATTATTTATTTACA
TATATTTCATATGCTTTCTGGCTTGGGAAGTGCACGGCGATTGTCAAATT
TTACAATATATGGTAGAGCAATCCAATGGAATTTTCACCTATCGCGATGC
GAGCGGATCTATCCAGCTGCAGCGCTTGGAAACAGTTCCATCCGGTGTCA
CTCTACTCGTGTACTGCAGTCCCTCGGTTTTCAAAGAAACTGTTTGCCAG
GACAATGGACAGTTCTCGGTCCCACTGCCCATGCGCTGTTTAAGTCCAAT
GCAACCGGTGACCAAGCATATTCGCGATGGGGATTGTGCGGGGAACCTGT
ATGCCGTGGGATATACCATAGATGGCAAGGATCTGGAGCTGTATCGCACA
TGTTTCGATTGCGGGCAGGGAAGACTCGTGTACTCGCAGAGCGATGTCTA
CTACAAAACGTTTTTTCCGAAGCGGCCATTTGTGGAGTTTGTGGCGGATG
AGATGTTCAGTCCGCAGGAGGCTGCTGCCTACATGAAGTCCAACATCTAT
TTTGCGTTCAAATGCATTTACGGTGATGACCAGTCCTACTTGCAAAATGC
CAACTACTTGGTGATTAATCGAGGACATATGGTGGCTTCCGCGGACTTCC
TGTTCACGGACCAGATGGGCAGTACTTTCCGCTATCTGAATGTGGTGCCG
CAATTCAAGTCAATTAACGATGGCAATTGGGAGAAAATTGAGAGATGGGT
GCGCAGTCAGATCCCGAAGTCGTCCTATTTCCGGGTCAAGTCCGGCGGAA
TTGGCATCTTGACATTGCCAGACACCAGGGGCTTCCTTCAGTCGGCTTTC
CTCGCCGGCTCCAAGATCCCGGTTCCCGAGTGGACCTACAAAGCGGTACG
GGATGCCACCGGCAATGGGCTGTACGTATTCCTCACTTACAATAGTACCT
TCCAAATGGAGAAGCCCCCGTGTCTGGCTATTTGTTACCCAGTTAATTGT
CCCATTCACCTCCCGAATAACCCGAACGATGGCTACACCTTCTGTTGCGA
TCCCAAGCGGTTCCCATATTAAAGAAGGAGAAGCATTTATGCATATTTTA
TCTAGGTACTGCTCGAAAATAAACCCACGTAATAATCGTCGGCTAAATAA
TTCAGTATTTTTGCTCAACATACGCACATATGTAAGCTGAAAATTGCGAA
AGTGCATCAACAAATGACATACACTGCACAAAAATCATATAAATTTCAAT
GAATATATATTTTACATCTCTTTATAAGGAGTGAAAATTAGAAAGAGTCA
AATCAGACGGTCAAATAAAAAATCGTATTATTTTAAAATCAAAAAAAAAA
AAAAAAA

IP10440.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG12917-RB 1490 CG12917-RB 1..1490 1..1490 7450 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6025937..6026811 615..1490 4200 99.1 Plus
chr2R 21145070 chr2R 6025485..6025878 221..614 1970 100 Plus
chr2R 21145070 chr2R 6025203..6025423 1..221 1090 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:01:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10138392..10139268 615..1491 4385 100 Plus
2R 25286936 2R 10137940..10138333 221..614 1970 100 Plus
2R 25286936 2R 10137656..10137876 1..221 1105 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10139591..10140467 615..1491 4385 100 Plus
2R 25260384 2R 10139139..10139532 221..614 1970 100 Plus
2R 25260384 2R 10138855..10139075 1..221 1105 100 Plus
Blast to na_te.dros performed 2019-03-16 08:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker4 7359 Stalker4 STALKER4 7359bp 6060..6187 1298..1421 126 58.9 Plus
Stalker 7256 Stalker STALKER 7256bp 5954..6081 1298..1421 126 58.9 Plus
blood 7410 blood BLOOD 7410bp 6137..6282 1294..1434 123 57.8 Plus

IP10440.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:34:34 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6025203..6025423 1..221 99 -> Plus
chr2R 6025486..6025878 222..614 100 -> Plus
chr2R 6025937..6026811 615..1490 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:45:58 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
CG12917-RB 1..1071 152..1222 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:07:22 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
CG12917-RB 1..1071 152..1222 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:47:59 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
CG12917-RB 1..1071 152..1222 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:52:17 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
CG12917-RB 1..1071 152..1222 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:43:38 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
CG12917-RB 1..1071 152..1222 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:57:27 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
CG12917-RB 1..1490 1..1490 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:07:22 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
CG12917-RB 1..1490 1..1490 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:47:59 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
CG12917-RB 1..1490 1..1490 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:52:17 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
CG12917-RB 1..1490 1..1490 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:43:38 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
CG12917-RB 1..1490 1..1490 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:34 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10138392..10139267 615..1490 100   Plus
2R 10137656..10137876 1..221 100 -> Plus
2R 10137941..10138333 222..614 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:34 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10138392..10139267 615..1490 100   Plus
2R 10137656..10137876 1..221 100 -> Plus
2R 10137941..10138333 222..614 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:34 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10138392..10139267 615..1490 100   Plus
2R 10137656..10137876 1..221 100 -> Plus
2R 10137941..10138333 222..614 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:47:59 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6025161..6025381 1..221 100 -> Plus
arm_2R 6025446..6025838 222..614 100 -> Plus
arm_2R 6025897..6026772 615..1490 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:27:14 Download gff for IP10440.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10138855..10139075 1..221 100 -> Plus
2R 10139140..10139532 222..614 100 -> Plus
2R 10139591..10140466 615..1490 100   Plus

IP10440.pep Sequence

Translation from 151 to 1221

> IP10440.pep
MKIAPMDCSYITLFIYIYFICFLAWEVHGDCQILQYMVEQSNGIFTYRDA
SGSIQLQRLETVPSGVTLLVYCSPSVFKETVCQDNGQFSVPLPMRCLSPM
QPVTKHIRDGDCAGNLYAVGYTIDGKDLELYRTCFDCGQGRLVYSQSDVY
YKTFFPKRPFVEFVADEMFSPQEAAAYMKSNIYFAFKCIYGDDQSYLQNA
NYLVINRGHMVASADFLFTDQMGSTFRYLNVVPQFKSINDGNWEKIERWV
RSQIPKSSYFRVKSGGIGILTLPDTRGFLQSAFLAGSKIPVPEWTYKAVR
DATGNGLYVFLTYNSTFQMEKPPCLAICYPVNCPIHLPNNPNDGYTFCCD
PKRFPY*

IP10440.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:40:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12781-PA 348 GF12781-PA 7..347 15..355 1342 72.1 Plus
Dana\GF16433-PA 242 GF16433-PA 1..240 116..354 584 44.6 Plus
Dana\GF16434-PA 351 GF16434-PA 16..349 26..354 580 36 Plus
Dana\GF19869-PA 250 GF19869-PA 1..238 116..354 291 31.3 Plus
Dana\GF10795-PA 424 GF10795-PA 152..407 116..354 194 25.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:40:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24146-PA 351 GG24146-PA 1..351 6..356 1596 84 Plus
Dere\GG12062-PA 351 GG12062-PA 21..349 28..354 720 41.6 Plus
Dere\GG12061-PA 346 GG12061-PA 2..344 13..354 717 40.8 Plus
Dere\GG11607-PA 369 GG11607-PA 40..357 49..354 336 29 Plus
Dere\GG11608-PA 370 GG11608-PA 3..358 7..354 328 27.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:40:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20125-PA 335 GH20125-PA 6..335 27..356 1077 58.2 Plus
Dgri\GH18691-PA 332 GH18691-PA 2..330 33..354 776 44.4 Plus
Dgri\GH18692-PA 332 GH18692-PA 2..330 33..354 750 44.7 Plus
Dgri\GH23404-PA 332 GH23404-PA 2..330 33..354 745 42.9 Plus
Dgri\GH23403-PA 342 GH23403-PA 2..340 10..354 712 40.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG12917-PB 356 CG12917-PB 1..356 1..356 1944 100 Plus
CG14062-PB 346 CG14062-PB 2..344 11..354 692 38.6 Plus
CG33346-PB 364 CG33346-PB 61..345 66..354 467 35.5 Plus
Sid-PA 370 CG9989-PA 3..358 7..354 335 27.6 Plus
CG14120-PA 1371 CG14120-PA 134..406 102..354 195 25.3 Plus
CG3819-PB 423 CG3819-PB 232..406 192..354 183 26.3 Plus
CG3819-PA 423 CG3819-PA 232..406 192..354 183 26.3 Plus
CG6839-PA 430 CG6839-PA 237..373 191..321 178 29.2 Plus
CG14120-PA 1371 CG14120-PA 624..957 34..354 170 22.8 Plus
CG14120-PA 1371 CG14120-PA 1129..1351 142..354 160 24.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:40:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19315-PA 347 GI19315-PA 7..347 17..356 1025 55.4 Plus
Dmoj\GI22179-PA 301 GI22179-PA 3..289 72..354 429 36.4 Plus
Dmoj\GI13641-PA 1340 GI13641-PA 589..863 34..301 182 25.2 Plus
Dmoj\GI13641-PA 1340 GI13641-PA 130..402 102..354 175 24.1 Plus
Dmoj\GI11823-PA 431 GI11823-PA 159..414 116..354 175 25.5 Plus
Dmoj\GI13641-PA 1340 GI13641-PA 965..1273 44..315 171 25.9 Plus
Dmoj\GI13492-PA 429 GI13492-PA 115..371 61..320 164 24.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11579-PA 371 GL11579-PA 42..370 27..355 1287 70.8 Plus
Dper\GL13697-PA 351 GL13697-PA 1..332 22..350 813 45.2 Plus
Dper\GL13696-PA 356 GL13696-PA 10..354 13..354 787 42.9 Plus
Dper\GL13695-PA 329 GL13695-PA 16..327 28..354 537 36.6 Plus
Dper\GL23183-PA 258 GL23183-PA 1..246 116..354 325 30.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11906-PA 320 GA11906-PA 1..319 37..355 1254 71.2 Plus
Dpse\GA26996-PB 369 GA26996-PB 10..350 13..350 799 44.9 Plus
Dpse\GA26995-PA 356 GA26995-PA 10..354 13..354 777 42.6 Plus
Dpse\GA12733-PA 346 GA12733-PA 16..344 28..354 698 41.8 Plus
Dpse\GA27180-PA 258 GA27180-PA 1..246 116..354 340 32 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21190-PA 320 GM21190-PA 1..320 37..356 1609 93.8 Plus
Dsec\GM12291-PA 351 GM12291-PA 6..349 13..354 751 41 Plus
Dsec\GM12290-PA 346 GM12290-PA 16..344 28..354 712 40 Plus
Dsec\GM12731-PA 357 GM12731-PA 61..345 66..354 453 35.2 Plus
Dsec\GM12732-PA 370 GM12732-PA 15..358 22..354 281 27.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10718-PA 325 GD10718-PA 1..325 37..356 1595 92 Plus
Dsim\GD18025-PA 351 GD18025-PA 6..349 13..354 744 40.1 Plus
Dsim\GD18024-PA 346 GD18024-PA 16..344 28..354 714 40.3 Plus
Dsim\GD21377-PA 275 GD21377-PA 61..264 66..272 309 33.7 Plus
Dsim\GD21378-PA 370 GD21378-PA 39..358 48..354 282 28.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22194-PA 320 GJ22194-PA 1..320 37..356 1094 60.9 Plus
Dvir\GJ24298-PA 514 GJ24298-PA 174..502 29..354 529 36.4 Plus
Dvir\GJ13524-PA 429 GJ13524-PA 157..367 116..315 188 28.4 Plus
Dvir\GJ13976-PA 1389 GJ13976-PA 700..909 102..301 184 27.6 Plus
Dvir\GJ13976-PA 1389 GJ13976-PA 131..403 102..354 184 25.4 Plus
Dvir\GJ11853-PA 428 GJ11853-PA 231..371 187..321 175 29.8 Plus
Dvir\GJ13976-PA 1389 GJ13976-PA 1100..1367 108..354 157 23.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18004-PA 321 GK18004-PA 1..321 37..356 1061 62.3 Plus
Dwil\GK10991-PA 350 GK10991-PA 19..349 26..355 794 43.2 Plus
Dwil\GK10989-PA 349 GK10989-PA 20..347 27..354 744 42.7 Plus
Dwil\GK10992-PA 255 GK10992-PA 1..243 116..354 453 39.4 Plus
Dwil\GK17844-PA 268 GK17844-PA 1..249 116..356 382 37.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19342-PA 320 GE19342-PA 1..320 37..356 1482 85 Plus
Dyak\GE10503-PA 351 GE10503-PA 21..349 28..354 719 40.7 Plus
Dyak\GE10502-PA 346 GE10502-PA 2..344 13..354 706 40.2 Plus
Dyak\GE10504-PA 251 GE10504-PA 1..239 116..354 334 33.5 Plus
Dyak\GE23796-PA 373 GE23796-PA 15..361 22..354 293 26.7 Plus

IP10440.hyp Sequence

Translation from 151 to 1221

> IP10440.hyp
MKIAPMDCSYITLFIYIYFICFLAWEVHGDCQILQYMVEQSNGIFTYRDA
SGSIQLQRLETVPSGVTLLVYCSPSVFKETVCQDNGQFSVPLPMRCLSPM
QPVTKHIRDGDCAGNLYAVGYTIDGKDLELYRTCFDCGQGRLVYSQSDVY
YKTFFPKRPFVEFVADEMFSPQEAAAYMKSNIYFAFKCIYGDDQSYLQNA
NYLVINRGHMVASADFLFTDQMGSTFRYLNVVPQFKSINDGNWEKIERWV
RSQIPKSSYFRVKSGGIGILTLPDTRGFLQSAFLAGSKIPVPEWTYKAVR
DATGNGLYVFLTYNSTFQMEKPPCLAICYPVNCPIHLPNNPNDGYTFCCD
PKRFPY*

IP10440.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG12917-PB 356 CG12917-PB 1..356 1..356 1944 100 Plus
CG14062-PB 346 CG14062-PB 2..344 11..354 692 38.6 Plus
CG33346-PB 364 CG33346-PB 61..345 66..354 467 35.5 Plus
CG9989-PA 370 CG9989-PA 3..358 7..354 335 27.6 Plus
CG14120-PA 1371 CG14120-PA 134..406 102..354 195 25.3 Plus