Clone IP10507 Report

Search the DGRC for IP10507

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:105
Well:7
Vector:pOT2
Associated Gene/TranscriptCG10357-RC
Protein status:IP10507.pep: gold
Preliminary Size:1101
Sequenced Size:1129

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10357 2005-01-01 Successful iPCR screen
CG10357 2008-04-29 Release 5.5 accounting
CG10357 2008-08-15 Release 5.9 accounting
CG10357 2008-12-18 5.12 accounting

Clone Sequence Records

IP10507.complete Sequence

1129 bp (1129 high quality bases) assembled on 2005-05-04

GenBank Submission: BT023367

> IP10507.complete
ATTACCTTAGACATGGCCAAGACCAGCTTATGTCTGGTACCAATTCTCTG
TCAATTTCTGGGACTACATGCCGCTTTGCTAGACTCTTTACTTAATCAGA
GTACCATATACTACCTTAAACCATCAGCGGATGTTTCCCTGGAGAATGTG
GAACAGTTGTCGTCTGTGGAATCTGTTAAGTTGATTGTCCACGGTTACCT
GGGATCTTGCACCCATGGCTCTATAATGCCTCTGAGAAATGCCTATACTG
CTCAGGGATATGAGAATGTTTTGGTGGCTGACTGGGGTCCTGTGGCCAAT
CTAGATTATCCCAGTTCGCGATTGGCTGTGAAGAACGTGGCCCAGATTCT
AGCCAAATTATTGGAGGAATTCCTACAGCGCCATGGGATCTCCTTAGAAG
GAGTCCATGTCATAGGACACAGCTTGGGAGCTCATATCGCAGGACGAATT
GGACGTTATTTCAACGGATCTTTGGGCAGAGTTACGGGTCTGGATCCGGC
TCTTCCCCTATTTTCAAGCCGATCGGATGATAGCTTGCACTCGAATGCCG
CTCAATTCGTGGATGTGATTCACACGGACTATCCCTTGTTTGGCGACATT
CGACCTCGAGGAACTGTGGACTTCTATCCGAATTTTGGACTGGCTCCACA
GCCAGGATGCGAAAATGTGGATGTTGTTGCTGCCAGTAAGCTACTCCACG
AGGCTTATAGTTGCAGTCACAATCGAGCAGTCATGTTCTACGCTGAATCA
ATTGGAATGCCTGAGAATTTTCCAGCGGTTTCTTGCAGTTTAACGGCCAT
TAAAAGTCGGCGTGTAGAGGACTGCCTAAGGGAAAAATCAAAAACTAATA
CAGAAAACGCAAATGATTATCAAACTGTCTTTATGGGCGAACATGTTAAC
CGCAGCGCCACCTTGTACTATTATTTGGAAACTAATGGAGCGCCACCCTA
CGGCCAGGGCAGGAACTCACATTTCTGATTTTACTTGTCGCACTTAAGTA
TAGATGGCGGTTAAACCCCGAAAACATGTATTTCTTCAGAAATAGATGCC
GCCACCTAACAACCCATTTGGACCCACATTCTATAAAAGAATATATTTTA
TTATAATTCTTAAAAAAAAAAAAAAAAAA

IP10507.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:49:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG10357-RC 1147 CG10357-RC 7..1121 1..1115 5575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:33:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3615058..3615523 241..706 2330 100 Plus
chr3L 24539361 chr3L 3614743..3614983 1..241 1205 100 Plus
chr3L 24539361 chr3L 3615836..3616043 904..1111 1040 100 Plus
chr3L 24539361 chr3L 3615583..3615781 707..905 995 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:02:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3615697..3616162 241..706 2330 100 Plus
3L 28110227 3L 3615382..3615622 1..241 1205 100 Plus
3L 28110227 3L 3616475..3616686 904..1115 1060 100 Plus
3L 28110227 3L 3616222..3616420 707..905 995 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3615697..3616162 241..706 2330 100 Plus
3L 28103327 3L 3615382..3615622 1..241 1205 100 Plus
3L 28103327 3L 3616475..3616686 904..1115 1060 100 Plus
3L 28103327 3L 3616222..3616420 707..905 995 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:33:17 has no hits.

IP10507.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:33:59 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3614743..3614983 1..241 100 -> Plus
chr3L 3615059..3615523 242..706 100 -> Plus
chr3L 3615583..3615781 707..905 100 -> Plus
chr3L 3615838..3616043 906..1111 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:46:11 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
CG10357-RC 1..966 13..978 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:45:01 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
CG10357-RC 1..966 13..978 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:57:29 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
CG10357-RC 1..966 13..978 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:25:54 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
CG10357-RB 37..1014 1..978 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:01:44 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
CG10357-RC 1..966 13..978 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:53:22 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
CG10357-RC 1..1111 1..1111 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:45:01 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
CG10357-RC 1..1111 1..1111 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:57:29 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
CG10357-RC 1..1111 1..1111 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:25:54 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
CG10357-RB 37..1147 1..1111 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:01:44 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
CG10357-RC 1..1111 1..1111 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:59 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3616222..3616420 707..905 100 -> Plus
3L 3616477..3616682 906..1111 100   Plus
3L 3615382..3615622 1..241 100 -> Plus
3L 3615698..3616162 242..706 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:59 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3616222..3616420 707..905 100 -> Plus
3L 3616477..3616682 906..1111 100   Plus
3L 3615382..3615622 1..241 100 -> Plus
3L 3615698..3616162 242..706 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:59 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3616222..3616420 707..905 100 -> Plus
3L 3616477..3616682 906..1111 100   Plus
3L 3615382..3615622 1..241 100 -> Plus
3L 3615698..3616162 242..706 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:57:29 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3615382..3615622 1..241 100 -> Plus
arm_3L 3615698..3616162 242..706 100 -> Plus
arm_3L 3616222..3616420 707..905 100 -> Plus
arm_3L 3616477..3616682 906..1111 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:58:53 Download gff for IP10507.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3615382..3615622 1..241 100 -> Plus
3L 3615698..3616162 242..706 100 -> Plus
3L 3616222..3616420 707..905 100 -> Plus
3L 3616477..3616682 906..1111 100   Plus

IP10507.hyp Sequence

Translation from 0 to 977

> IP10507.hyp
ITLDMAKTSLCLVPILCQFLGLHAALLDSLLNQSTIYYLKPSADVSLENV
EQLSSVESVKLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADWGPVAN
LDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRI
GRYFNGSLGRVTGLDPALPLFSSRSDDSLHSNAAQFVDVIHTDYPLFGDI
RPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAES
IGMPENFPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVN
RSATLYYYLETNGAPPYGQGRNSHF*

IP10507.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG10357-PC 321 CG10357-PC 1..321 5..325 1678 100 Plus
CG7367-PD 358 CG7367-PD 95..351 44..320 375 33.6 Plus
CG7367-PB 358 CG7367-PB 95..351 44..320 375 33.6 Plus
CG7367-PC 389 CG7367-PC 126..382 44..320 375 33.6 Plus
CG6277-PA 341 CG6277-PA 83..338 40..318 360 32 Plus

IP10507.pep Sequence

Translation from 0 to 977

> IP10507.pep
ITLDMAKTSLCLVPILCQFLGLHAALLDSLLNQSTIYYLKPSADVSLENV
EQLSSVESVKLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADWGPVAN
LDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRI
GRYFNGSLGRVTGLDPALPLFSSRSDDSLHSNAAQFVDVIHTDYPLFGDI
RPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAES
IGMPENFPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVN
RSATLYYYLETNGAPPYGQGRNSHF*

IP10507.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24216-PA 324 GF24216-PA 1..288 5..301 1184 73.7 Plus
Dana\GF15222-PA 341 GF15222-PA 48..313 46..322 360 35.1 Plus
Dana\GF22963-PA 338 GF22963-PA 98..337 59..320 343 34 Plus
Dana\GF22959-PA 341 GF22959-PA 102..338 59..318 337 31.3 Plus
Dana\GF22960-PA 339 GF22960-PA 99..337 59..319 337 33 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15150-PA 356 GG15150-PA 1..297 5..301 1440 89.9 Plus
Dere\GG10541-PA 340 GG10541-PA 48..312 46..321 359 32.8 Plus
Dere\GG12149-PA 341 GG12149-PA 83..338 40..318 355 31.3 Plus
Dere\GG12155-PA 338 GG12155-PA 59..337 29..320 354 33.9 Plus
Dere\GG12148-PA 330 GG12148-PA 102..294 59..262 351 37.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16420-PA 321 GH16420-PA 1..320 5..325 1109 65.9 Plus
Dgri\GH23239-PA 218 GH23239-PA 78..217 183..325 508 65.7 Plus
Dgri\GH10838-PA 341 GH10838-PA 37..316 33..321 384 35.3 Plus
Dgri\GH18961-PA 336 GH18961-PA 47..336 19..321 359 32.7 Plus
Dgri\GH11499-PA 384 GH11499-PA 73..316 59..321 349 36.7 Plus
Dgri\GH23239-PA 218 GH23239-PA 1..67 5..69 164 56.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG10357-PC 321 CG10357-PC 1..321 5..325 1678 100 Plus
CG7367-PD 358 CG7367-PD 95..351 44..320 375 33.6 Plus
CG7367-PB 358 CG7367-PB 95..351 44..320 375 33.6 Plus
CG7367-PC 389 CG7367-PC 126..382 44..320 375 33.6 Plus
CG6277-PA 341 CG6277-PA 83..338 40..318 360 32 Plus
CG6295-PA 338 CG6295-PA 59..337 29..320 351 33.6 Plus
CG6271-PA 341 CG6271-PA 103..338 60..318 347 33.3 Plus
CG17292-PD 340 CG17292-PD 48..312 46..321 340 32.4 Plus
CG17292-PC 340 CG17292-PC 48..312 46..321 340 32.4 Plus
CG17292-PB 340 CG17292-PB 48..312 46..321 340 32.4 Plus
CG17292-PA 340 CG17292-PA 48..312 46..321 340 32.4 Plus
CG6472-PB 389 CG6472-PB 81..331 61..323 330 36 Plus
CG14034-PC 338 CG14034-PC 37..313 32..322 325 33.1 Plus
CG14034-PB 338 CG14034-PB 37..313 32..322 325 33.1 Plus
CG34447-PA 389 CG34447-PA 74..317 59..321 325 34.8 Plus
CG34447-PB 389 CG34447-PB 74..317 59..321 325 34.8 Plus
CG6296-PA 676 CG6296-PA 75..344 27..320 325 31 Plus
CG17191-PA 337 CG17191-PA 54..335 25..319 315 29.6 Plus
CG4582-PA 432 CG4582-PA 158..419 52..323 315 31.2 Plus
CG17192-PA 337 CG17192-PA 80..335 42..319 313 30.6 Plus
CG6283-PA 339 CG6283-PA 100..337 60..319 302 30.8 Plus
CG18641-PC 369 CG18641-PC 106..353 60..320 301 30.7 Plus
CG6847-PB 1000 CG6847-PB 179..445 41..310 299 33.6 Plus
CG6847-PA 1000 CG6847-PA 179..445 41..310 299 33.6 Plus
CG34448-PA 344 CG34448-PA 76..323 59..320 292 30.3 Plus
sxe2-PB 387 CG4979-PB 79..361 31..318 289 29.2 Plus
sxe2-PA 387 CG4979-PA 79..361 31..318 289 29.2 Plus
CG18258-PA 468 CG18258-PA 209..452 61..322 277 30.2 Plus
CG5966-PB 436 CG5966-PB 11..290 61..317 276 32.6 Plus
CG5966-PA 540 CG5966-PA 115..394 61..317 276 32.6 Plus
CG13282-PB 484 CG13282-PB 116..310 60..263 270 34.3 Plus
CG13282-PA 484 CG13282-PA 116..310 60..263 270 34.3 Plus
CG5665-PB 376 CG5665-PB 90..360 38..323 262 29.8 Plus
CG1986-PB 404 CG1986-PB 83..353 47..325 249 28.6 Plus
CG1986-PA 404 CG1986-PA 83..353 47..325 249 28.6 Plus
CG6675-PC 386 CG6675-PC 150..385 60..321 247 27.2 Plus
CG6675-PB 390 CG6675-PB 154..389 60..321 247 27.2 Plus
CG5162-PB 411 CG5162-PB 156..370 81..318 239 31.3 Plus
CG5162-PA 411 CG5162-PA 156..370 81..318 239 31.3 Plus
CG5665-PC 395 CG5665-PC 90..379 38..323 232 28 Plus
CG4267-PB 374 CG4267-PB 108..354 60..320 229 28.2 Plus
CG4267-PA 374 CG4267-PA 108..354 60..320 229 28.2 Plus
Yp3-PB 420 CG11129-PB 186..407 79..324 210 29.9 Plus
Yp3-PA 420 CG11129-PA 186..407 79..324 210 29.9 Plus
Yp1-PB 439 CG2985-PB 194..412 78..319 202 27.7 Plus
Yp1-PA 439 CG2985-PA 194..412 78..319 202 27.7 Plus
CG6431-PB 346 CG6431-PB 94..286 62..262 201 29.5 Plus
CG6431-PC 351 CG6431-PC 99..291 62..262 201 29.5 Plus
CG10116-PA 289 CG10116-PA 102..282 110..320 167 27 Plus
Yp2-PB 442 CG2979-PB 223..372 108..263 161 31.7 Plus
Yp2-PA 442 CG2979-PA 223..372 108..263 161 31.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12499-PA 329 GI12499-PA 1..328 5..325 1123 63.9 Plus
Dmoj\GI23284-PA 341 GI23284-PA 102..339 59..319 376 34.6 Plus
Dmoj\GI23291-PA 337 GI23291-PA 48..336 19..320 372 34.7 Plus
Dmoj\GI17353-PA 344 GI17353-PA 37..317 33..322 372 35.9 Plus
Dmoj\GI23286-PA 292 GI23286-PA 53..290 59..319 346 32.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16676-PA 332 GL16676-PA 1..325 5..323 1286 72.6 Plus
Dper\GL19227-PA 342 GL19227-PA 37..313 33..321 376 36 Plus
Dper\GL23624-PA 341 GL23624-PA 83..338 40..318 363 32 Plus
Dper\GL23622-PA 341 GL23622-PA 102..338 59..318 362 34.4 Plus
Dper\GL23625-PA 339 GL23625-PA 82..337 42..319 351 32.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10269-PA 332 GA10269-PA 1..325 5..323 1278 72.3 Plus
Dpse\GA14444-PA 342 GA14444-PA 37..313 33..321 376 36 Plus
Dpse\GA26666-PA 341 GA26666-PA 102..338 59..318 362 34.4 Plus
Dpse\GA26667-PA 341 GA26667-PA 102..338 59..318 353 34 Plus
Dpse\GA26669-PA 339 GA26669-PA 83..337 43..319 353 32.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14582-PA 257 GM14582-PA 1..231 5..235 1188 97.4 Plus
Dsec\GM10142-PA 341 GM10142-PA 83..338 40..318 363 31.7 Plus
Dsec\GM16918-PA 340 GM16918-PA 48..312 46..321 354 32.4 Plus
Dsec\GM10148-PA 338 GM10148-PA 59..337 29..320 348 33.6 Plus
Dsec\GM10141-PA 225 GM10141-PA 5..222 78..318 342 35.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13775-PA 402 GD13775-PA 1..298 5..303 1509 95.7 Plus
Dsim\GD18101-PA 341 GD18101-PA 83..338 40..318 359 31.3 Plus
Dsim\GD18100-PA 341 GD18100-PA 102..338 59..318 354 34 Plus
Dsim\GD23531-PA 340 GD23531-PA 11..312 15..321 354 30.3 Plus
Dsim\GD18105-PA 338 GD18105-PA 59..337 29..320 347 33.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:35:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12405-PA 329 GJ12405-PA 1..328 5..325 1117 63.9 Plus
Dvir\GJ16163-PA 344 GJ16163-PA 37..316 33..321 373 35.3 Plus
Dvir\GJ24141-PA 341 GJ24141-PA 102..339 59..319 366 33.8 Plus
Dvir\GJ24146-PA 336 GJ24146-PA 47..335 19..320 356 33.1 Plus
Dvir\GJ21013-PA 371 GJ21013-PA 47..329 26..319 344 34.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:35:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20519-PA 304 GK20519-PA 4..303 6..301 1081 65.8 Plus
Dwil\GK24161-PA 341 GK24161-PA 37..313 33..321 374 36.3 Plus
Dwil\GK12050-PA 337 GK12050-PA 97..336 59..320 364 35.5 Plus
Dwil\GK12042-PA 342 GK12042-PA 84..339 40..318 348 31.7 Plus
Dwil\GK22029-PA 364 GK22029-PA 30..315 26..319 345 32 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21372-PA 324 GE21372-PA 1..297 5..301 1487 93.3 Plus
Dyak\GE10595-PA 341 GE10595-PA 95..338 52..318 353 31.2 Plus
Dyak\GE18762-PA 340 GE18762-PA 11..312 15..321 350 30.3 Plus
Dyak\GE10600-PA 338 GE10600-PA 59..337 29..320 343 33.2 Plus
Dyak\GE10594-PA 341 GE10594-PA 102..338 59..318 342 32.4 Plus