Clone IP10568 Report

Search the DGRC for IP10568

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:105
Well:68
Vector:pOT2
Associated Gene/TranscriptCG13776-RA
Protein status:IP10568.pep: validated not full length
Preliminary Size:1080
Sequenced Size:1182

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13776 2005-01-01 Successful iPCR screen
CG13776 2008-04-29 Release 5.5 accounting
CG13776 2008-08-15 Release 5.9 accounting
CG13776 2008-12-18 5.12 accounting

Clone Sequence Records

IP10568.complete Sequence

1182 bp (1182 high quality bases) assembled on 2005-05-04

GenBank Submission: BT023315

> IP10568.complete
TTGGCTGGGAATCTGTTCAAAGGATCCGTAGCAATCAGATTCGGTCGCTT
GCTGCATCTCAAGCGCAAGGAGGTTTATATGGAATGCTTCCGCATCCTGG
GCGTTCACGAATCAGCTGATCAGAATACGGTACGCCACGCCTACTTGGAT
CTGGTGAAACGGGTGCATCCCGATTCGGGAACGGAGGAGGCCAGTGCCGA
ACGCTTCCAGCAGGTGGACGAGGCTTTCCGTGTGCTGCAGGAAAAGTTCG
CCAAGGGAAGGCGAAACATTCAGGAGGACGAGGAGGGGGCCATGGAGTTT
GACATCAAGCATACGGCGCCGCAGCACCGGCAATATCTGTCCAACGAGGG
CATCGGAGTGGGAACTCCATTTCAGCGGCAAAAGCAGTACCAGCAGGTGC
GCGCCATGAAGGCTCAGGAACGCGTCCTGGAGCACCGCATCGACAAGGCG
GCTGCCGGAGAGAAAACACTAATGTCCAAGGGCGGCAGCCACTTTCGGAA
ACATGCTATTAAGACCAAGTACGGTATTGATCGTGTGGTCGAGGATCTCA
TTCAGGAGGCCATGTCCAAGGGTGACTTTAACAATCTAAACGGGTCTGGA
AAGCCCCTGTCCTCGGCTCAGTCGCAGAATCCCTATCTGGACTTTACGAC
CCACAAGTTGAACAAGATTATGTTAGACAACGGCTTCACGCCGGAATGGA
TAAGCCTGGGCAAGGATATTCGCGATGCGATTGCTCAGCTGAAGACGAAA
CTGCGCCAGGAGCGCAAATACTACGGCGAATGGCCATTGCAGCGCCCGGA
CGATCTGGCAGCCTGGAAAATATTCACGCTGAATCACCAGGACGATGTGA
AGCAATTGAACAAACTCATTGACAAGTACAATCTAATAGTGCCCATTCTG
GAAAATCAGTTCTTTCGCCTGCATCTCGACAGAATGGCCGAACCTATATT
TAAGGATCCGGAATTGCAACGTAACGTAATCAGACCCGAAATGAAATCTA
AGCCCAGCAGCAATCTAGAGAATCAGGGCAGCGCTAGTACAAGTTTATTT
TCCCTAATTAGCAAACTATTGTAATTAAAAATGTGTGATTGTAAAATATG
TGATATTAGATGTAGATTAAGGTGCTGTACGTTTATGTGTACAATATATG
TACGAAATAGTTCAATAAAAAAAAAAAAAAAA

IP10568.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:25:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13776-RA 1423 CG13776-RA 192..1359 1..1168 5840 100 Plus
CG13776-RB 1293 CG13776-RB 181..1267 82..1168 5435 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7012704..7013789 81..1166 5415 99.9 Plus
chr2L 23010047 chr2L 7012554..7012635 1..82 380 97.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:02:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:26:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7013652..7014739 81..1168 5440 100 Plus
2L 23513712 2L 7013502..7013583 1..82 410 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7013652..7014739 81..1168 5440 100 Plus
2L 23513712 2L 7013502..7013583 1..82 410 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:26:37 has no hits.

IP10568.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:27:25 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7012554..7012634 1..81 97 -> Plus
chr2L 7012705..7013789 82..1166 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:46:24 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
CG13776-RA 7..1080 1..1074 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:43:26 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
CG13776-RA 7..1080 1..1074 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:51:37 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
CG43322-RA 7..1080 1..1074 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:26:17 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
CG13776-RA 7..1080 1..1074 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:18:25 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
CG43322-RA 7..1080 1..1074 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:18:04 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
CG13776-RA 107..1272 1..1166 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:43:26 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
CG13776-RA 107..1272 1..1166 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:51:37 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
CG43322-RA 107..1272 1..1166 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:26:17 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
CG13776-RA 107..1272 1..1166 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:18:25 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
CG43322-RA 107..1272 1..1166 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:27:25 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7013502..7013582 1..81 100 -> Plus
2L 7013653..7014737 82..1166 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:27:25 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7013502..7013582 1..81 100 -> Plus
2L 7013653..7014737 82..1166 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:27:25 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7013502..7013582 1..81 100 -> Plus
2L 7013653..7014737 82..1166 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:51:37 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7013502..7013582 1..81 100 -> Plus
arm_2L 7013653..7014737 82..1166 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:04:56 Download gff for IP10568.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7013653..7014737 82..1166 100   Plus
2L 7013502..7013582 1..81 100 -> Plus

IP10568.pep Sequence

Translation from 0 to 1073

> IP10568.pep
LAGNLFKGSVAIRFGRLLHLKRKEVYMECFRILGVHESADQNTVRHAYLD
LVKRVHPDSGTEEASAERFQQVDEAFRVLQEKFAKGRRNIQEDEEGAMEF
DIKHTAPQHRQYLSNEGIGVGTPFQRQKQYQQVRAMKAQERVLEHRIDKA
AAGEKTLMSKGGSHFRKHAIKTKYGIDRVVEDLIQEAMSKGDFNNLNGSG
KPLSSAQSQNPYLDFTTHKLNKIMLDNGFTPEWISLGKDIRDAIAQLKTK
LRQERKYYGEWPLQRPDDLAAWKIFTLNHQDDVKQLNKLIDKYNLIVPIL
ENQFFRLHLDRMAEPIFKDPELQRNVIRPEMKSKPSSNLENQGSASTSLF
SLISKLL*

IP10568.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14954-PA 362 GF14954-PA 3..362 1..357 1558 80.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10451-PA 359 GG10451-PA 3..359 1..357 1859 96.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13276-PA 369 GH13276-PA 22..344 16..330 1339 77.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG43322-PA 359 CG43322-PA 3..359 1..357 1846 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17469-PA 359 GI17469-PA 21..358 16..353 1357 73.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25975-PA 362 GL25975-PA 4..362 2..357 1431 74.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12517-PA 362 GA12517-PA 4..362 2..357 1435 74.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16270-PA 359 GM16270-PA 3..359 1..357 1851 95.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23445-PA 359 GD23445-PA 3..359 1..357 1831 95.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14504-PA 359 GJ14504-PA 7..358 1..353 1348 71.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15270-PA 337 GK15270-PA 1..337 20..356 1345 74.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14286-PA 359 GE14286-PA 3..359 1..357 1835 95.2 Plus

IP10568.hyp Sequence

Translation from 0 to 1073

> IP10568.hyp
LAGNLFKGSVAIRFGRLLHLKRKEVYMECFRILGVHESADQNTVRHAYLD
LVKRVHPDSGTEEASAERFQQVDEAFRVLQEKFAKGRRNIQEDEEGAMEF
DIKHTAPQHRQYLSNEGIGVGTPFQRQKQYQQVRAMKAQERVLEHRIDKA
AAGEKTLMSKGGSHFRKHAIKTKYGIDRVVEDLIQEAMSKGDFNNLNGSG
KPLSSAQSQNPYLDFTTHKLNKIMLDNGFTPEWISLGKDIRDAIAQLKTK
LRQERKYYGEWPLQRPDDLAAWKIFTLNHQDDVKQLNKLIDKYNLIVPIL
ENQFFRLHLDRMAEPIFKDPELQRNVIRPEMKSKPSSNLENQGSASTSLF
SLISKLL*

IP10568.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG43322-PA 359 CG43322-PA 3..359 1..357 1846 100 Plus