Clone IP10578 Report

Search the DGRC for IP10578

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:105
Well:78
Vector:pOT2
Associated Gene/TranscriptCG14074-RB
Protein status:IP10578.pep: gold
Preliminary Size:1011
Sequenced Size:1362

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14074 2005-01-01 Successful iPCR screen
CG14074 2008-04-29 Release 5.5 accounting
CG14074 2008-08-15 Release 5.9 accounting
CG14074 2008-12-18 5.12 accounting

Clone Sequence Records

IP10578.complete Sequence

1362 bp (1362 high quality bases) assembled on 2006-01-24

GenBank Submission: BT024332

> IP10578.complete
AAACACAAAAAATGGAAATGGACGCAGACCTAACAAAGTAAATATTTATA
TTACAATCCGATATATTTTTAATTAATTTGATGCTCTCACGTTAGTCAGG
CGATTGCCGAGCTAATGCGCGAGATCGAAGGTGCAAATGCCAGTGTCAGC
ACCTCGAAACAAAGCGAACGCAAAGTGAATCCTCTGGGCAAACTAAACAA
ACGCTTCTTAGGCCGCACCATAAACACCGCGATTCGGCATAATGATAGAG
AAAAGGAGCGCACACAGGCAAATTGCCGACAGAAGCTGCAGGATCTGGAT
GATGTGCACGAAAGGAGGAAGTCCAACTACTTTTACAGCCGCGATGCACC
CAGAACTCAAAGTGTTGATAGAAGCAGAAGTTCCAGCAGAAGGCGCAGCA
GGAGCCGCCACAAAAAGGCCAAGAAGCATCGCAGCCGAAGAAGAACTAGG
AGCAGCAGAAGTTCAAGCCGCAGTCGAAGTCGCAGCAGTTCACATCGGCG
AAAAAAGCGCAAAAAGAAGGTTAAAAAACACAAAAAATCACACAGAAGAC
GAAGAAGCAGCCAGAGCAGCAGCGGTTGCGATTGGGAATCCGCACCCAGC
GAGTCGTTACGTATACCCCCGCCTTCAGATGTGTTCCTAAACCACTCCAA
GCAAATGGCTCTTGCAGTGGCCATGGCCTATGGTCAATTACTAAACCCGA
GCAGCCAAAAGAAAGCCAGCGAGTCTAAGGAACACTCCTCCTCTCCTATA
AGCGATATATTCCGGGAACTTATGTCCGACGAAGAGGTGGACAAATCCGA
GAAGCCCGAGGCCCTGTCCATTTCATCCAGCGACGAAGAGCCAAATGTTC
TCACCATTAAAGTAAGCTCGAGCTCCGAGTCCAGCGGCAATAAATCAAGC
TCGGACTCAGATTCAGAAGCAAAGAACAGCGTACGCAGCTGTATAACCCT
AGAATCTGGTGATAATAGTGATATTGAGATAATTGAGTACCATGAAGAGC
CCAAAAAAAAGGCATGTGAAACTGAACCTGCGTCTGAACCTGAATATCCG
TCTCAATCGGATAGCACAAATCAACAAGTGGACGATAGCACAGCTGTCAC
TACAGTGGACCTGACCGAGGATTAATTAGGCTAAACTTTAGTTAGAGAAT
CGTTATGTAAGATCAGAATGAAATTTTAAAGGAAACAAACTGAAGTTGAA
CCAAACTAAGAATATTGTTTTTATATTATTATTACAGATATAAGCTCTGC
CATAGATAGATTCATATTTGGTTGGTTTTTTTTTAAGTTATGTTTAATAG
TAATATACTAAATATACCACCGAATGATAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAA

IP10578.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:20:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14074-RA 1329 CG14074-RA 1..1329 1..1329 6645 100 Plus
CG14074.a 1330 CG14074.a 97..1330 96..1329 6170 100 Plus
CG14074.a 1330 CG14074.a 60..96 1..37 185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:29:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18855836..18857163 1..1328 6400 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:02:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:29:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18866225..18867553 1..1329 6645 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18859325..18860653 1..1329 6645 100 Plus
Blast to na_te.dros performed 2019-03-15 15:29:43
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1134..1256 1207..1325 144 62.9 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1033..1166 1178..1310 136 57.8 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1020..1180 1154..1316 134 57 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1148..1250 1207..1312 134 62.3 Plus
roo 9092 roo DM_ROO 9092bp 1063..1155 431..520 132 66 Plus

IP10578.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:30:40 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18855836..18857163 1..1328 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:46:25 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
CG14074-RA 1..1011 115..1125 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:35:37 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
CG14074-RA 1..1011 115..1125 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:30:17 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
CG14074-RB 1..1011 115..1125 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:10:15 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
CG14074-RA 1..1011 115..1125 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:07:59 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
CG14074-RB 1..1011 115..1125 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:07:06 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
CG14074-RA 1..1328 1..1328 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:35:37 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
CG14074-RA 1..1328 1..1328 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:30:17 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
CG14074-RB 38..1149 96..1207 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:10:15 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
CG14074-RA 1..1328 1..1328 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:07:59 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
CG14074-RB 38..1149 96..1207 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:40 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18866225..18867552 1..1328 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:40 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18866225..18867552 1..1328 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:40 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18866225..18867552 1..1328 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:30:17 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18859325..18860652 1..1328 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:59:22 Download gff for IP10578.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18859325..18860652 1..1328 100   Plus

IP10578.pep Sequence

Translation from 114 to 1124

> IP10578.pep
MREIEGANASVSTSKQSERKVNPLGKLNKRFLGRTINTAIRHNDREKERT
QANCRQKLQDLDDVHERRKSNYFYSRDAPRTQSVDRSRSSSRRRSRSRHK
KAKKHRSRRRTRSSRSSSRSRSRSSSHRRKKRKKKVKKHKKSHRRRRSSQ
SSSGCDWESAPSESLRIPPPSDVFLNHSKQMALAVAMAYGQLLNPSSQKK
ASESKEHSSSPISDIFRELMSDEEVDKSEKPEALSISSSDEEPNVLTIKV
SSSSESSGNKSSSDSDSEAKNSVRSCITLESGDNSDIEIIEYHEEPKKKA
CETEPASEPEYPSQSDSTNQQVDDSTAVTTVDLTED*

IP10578.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20048-PA 343 GF20048-PA 1..74 1..74 274 67.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16006-PA 350 GG16006-PA 16..350 1..336 947 82.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:16:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14377-PA 349 GH14377-PA 15..349 1..336 460 44.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG14074-PB 336 CG14074-PB 1..336 1..336 1689 100 Plus
Srp54-PA 513 CG4602-PA 284..509 45..287 175 29 Plus
CG6695-PA 961 CG6695-PA 403..709 57..330 174 27.2 Plus
BOD1-PC 1109 CG5514-PC 592..925 41..336 166 24 Plus
BOD1-PA 1109 CG5514-PA 592..925 41..336 166 24 Plus
BOD1-PD 1150 CG5514-PD 592..925 41..336 166 24 Plus
BOD1-PB 1150 CG5514-PB 592..925 41..336 166 24 Plus
BOD1-PE 1151 CG5514-PE 592..925 41..336 166 24 Plus
CG5808-PA 653 CG5808-PA 406..651 13..272 163 26.1 Plus
CG6695-PB 715 CG6695-PB 403..677 57..288 160 27.3 Plus
CG3918-PA 321 CG3918-PA 92..268 41..218 156 27.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:16:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24884-PA 96 GL24884-PA 16..72 1..58 143 63.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:16:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12746-PA 348 GA12746-PA 16..348 1..336 431 47.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:16:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14995-PA 333 GM14995-PA 1..333 1..336 1135 91.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:16:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14773-PA 333 GD14773-PA 1..333 1..336 1155 92.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:16:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11576-PA 319 GJ11576-PA 1..319 1..336 427 43.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19162-PA 334 GK19162-PA 1..334 1..336 341 36.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19568-PA 350 GE19568-PA 16..350 1..336 959 80.7 Plus
Dyak\GE23084-PA 335 GE23084-PA 1..335 1..336 952 80.4 Plus

IP10578.hyp Sequence

Translation from 114 to 1124

> IP10578.hyp
MREIEGANASVSTSKQSERKVNPLGKLNKRFLGRTINTAIRHNDREKERT
QANCRQKLQDLDDVHERRKSNYFYSRDAPRTQSVDRSRSSSRRRSRSRHK
KAKKHRSRRRTRSSRSSSRSRSRSSSHRRKKRKKKVKKHKKSHRRRRSSQ
SSSGCDWESAPSESLRIPPPSDVFLNHSKQMALAVAMAYGQLLNPSSQKK
ASESKEHSSSPISDIFRELMSDEEVDKSEKPEALSISSSDEEPNVLTIKV
SSSSESSGNKSSSDSDSEAKNSVRSCITLESGDNSDIEIIEYHEEPKKKA
CETEPASEPEYPSQSDSTNQQVDDSTAVTTVDLTED*

IP10578.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG14074-PB 336 CG14074-PB 1..336 1..336 1689 100 Plus
Srp54-PA 513 CG4602-PA 284..509 45..287 175 29 Plus
CG6695-PA 961 CG6695-PA 403..709 57..330 174 27.2 Plus
CG5514-PC 1109 CG5514-PC 592..925 41..336 166 24 Plus
CG5514-PA 1109 CG5514-PA 592..925 41..336 166 24 Plus