Clone IP10581 Report

Search the DGRC for IP10581

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:105
Well:81
Vector:pOT2
Associated Gene/TranscriptCG14383-RA
Protein status:IP10581.pep: gold
Preliminary Size:999
Sequenced Size:1155

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14383 2005-01-01 Successful iPCR screen
CG14383 2008-04-29 Release 5.5 accounting
CG14383 2008-08-15 Release 5.9 accounting
CG14383 2008-12-18 5.12 accounting

Clone Sequence Records

IP10581.complete Sequence

1155 bp (1155 high quality bases) assembled on 2005-02-26

GenBank Submission: BT023311

> IP10581.complete
AAATCTTGGAGACATGGCCAAACCGTTTTCTTTGACAGAGGAGAAGCTAG
ATGACCTATTTGTGCAGGAGGTTGTCAGTGTGGTGAAACTGGTGGACATG
CTGCCCGATAAAGATAACATTGTGCCCACATGCACCCGATGGCTCAACAT
CTTCCAGCAGTCAACGCCGAAGGAACGCTTTTCCAGAAACTATATGCTAC
TGCTCCTTCATAAACAACTCAATGATCACAAATCGTTGGGTTATCCATTT
ACGTGGCCGGGCAGTTTCCAGTTGGATTTGCGCACTCTTCACCAAATGAG
CCTAAAACCGAATCCCGCAATCGGCAAAGATGTTGTATGCTGCAAATTTG
ATGAAAGTTTGAATGAGGAGGAACAGTCTTCTTTTAGTTCATGCGAGAAT
ATAGTGGAGGCCAATCGTAGGTTGGTCAAAGAAAACGCTGCACTAACCAA
GGAGTCGATGGAGCTTCAATGTCTGATCGATAAGTTGCAGGTGAAACGCG
CGGCGGACAAACATGCCATTAAAAGGATAAATGATCAGATTTACATGCTG
GACAAGGAGAACCGATATCTGAAGCGAAATTTCGCCTGCTCCTCAATCAG
CGCCCTAAAAAGACTATGCAATGGACAGGATCCGGCGATGTTTTTTGACA
CCATGTTCAGTGTTTTCTGCGAAGACGTATCAGACCACCAGCAGGTGCAG
CACTTTAACGAACTCTTCAAAACCTTGCTACATGCCCACATGGATCACTA
CCGGCGACAGCAGCGTGCTCCTCTGATGGAGGAGGCAAGCCAAAGTTTTG
ACAATCTGAAAGCCCAGGTGAGCAAGAGATACAAAAATGTGTTGGGCATG
AAATTGGATGCCGAGAGCCACGAGCTCACCCTCAGTGCCATGAGATATCT
AGCCGTCCTGCGAAAATTGTTCAAGGCCACCTTTAAGGGCAAAGCGAGCA
CCAAGAAGGCAGTACTCAAGTTCCTGCAGCACAACTACGAGCTTATGAAC
GAGATGTTGTAGGATGGATTCACTCACCTGGGAATCAGTCGTTCGCATTG
CAGAATGTGCTCCAAATTTAGGACTTGATCTACAATTTTAGGTTATATTT
TGTAATGTTAGAGTAAAAATTAAATATATTTAGGTTAAAAAAAAAAAAAA
AAAAA

IP10581.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14383-RA 1136 CG14383-RA 1..1136 1..1136 5680 100 Plus
CG31342-RB 4005 CG31342-RB 1242..1294 1080..1028 265 100 Minus
CG31342-RC 4112 CG31342-RC 1241..1293 1080..1028 265 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8812630..8813765 1136..1 5650 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:02:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:43:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12987366..12988511 1146..1 5700 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12728197..12729342 1146..1 5700 99.8 Minus
Blast to na_te.dros performed on 2019-03-16 23:43:21 has no hits.

IP10581.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:44:20 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8812654..8813765 1..1112 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:46:26 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
CG14383-RA 1..999 14..1012 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:11:04 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
CG14383-RA 1..999 14..1012 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:48:18 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
CG14383-RA 1..999 14..1012 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:55:45 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
CG14383-RA 1..999 14..1012 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:56:51 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
CG14383-RA 1..999 14..1012 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:04:44 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
CG14383-RA 1..999 14..1012 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:11:03 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
CG14383-RA 1..1136 1..1136 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:48:18 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
CG14383-RA 1..1136 1..1136 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:55:45 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
CG14383-RA 1..999 14..1012 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:56:51 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
CG14383-RA 1..1136 1..1136 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:20 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12987376..12988511 1..1136 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:20 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12987376..12988511 1..1136 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:20 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12987376..12988511 1..1136 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:48:18 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8813098..8814233 1..1136 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:30:58 Download gff for IP10581.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12728207..12729342 1..1136 100   Minus

IP10581.hyp Sequence

Translation from 0 to 1011

> IP10581.hyp
NLGDMAKPFSLTEEKLDDLFVQEVVSVVKLVDMLPDKDNIVPTCTRWLNI
FQQSTPKERFSRNYMLLLLHKQLNDHKSLGYPFTWPGSFQLDLRTLHQMS
LKPNPAIGKDVVCCKFDESLNEEEQSSFSSCENIVEANRRLVKENAALTK
ESMELQCLIDKLQVKRAADKHAIKRINDQIYMLDKENRYLKRNFACSSIS
ALKRLCNGQDPAMFFDTMFSVFCEDVSDHQQVQHFNELFKTLLHAHMDHY
RRQQRAPLMEEASQSFDNLKAQVSKRYKNVLGMKLDAESHELTLSAMRYL
AVLRKLFKATFKGKASTKKAVLKFLQHNYELMNEML*

IP10581.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG14383-PA 332 CG14383-PA 1..332 5..336 1721 100 Plus

IP10581.pep Sequence

Translation from 13 to 1011

> IP10581.pep
MAKPFSLTEEKLDDLFVQEVVSVVKLVDMLPDKDNIVPTCTRWLNIFQQS
TPKERFSRNYMLLLLHKQLNDHKSLGYPFTWPGSFQLDLRTLHQMSLKPN
PAIGKDVVCCKFDESLNEEEQSSFSSCENIVEANRRLVKENAALTKESME
LQCLIDKLQVKRAADKHAIKRINDQIYMLDKENRYLKRNFACSSISALKR
LCNGQDPAMFFDTMFSVFCEDVSDHQQVQHFNELFKTLLHAHMDHYRRQQ
RAPLMEEASQSFDNLKAQVSKRYKNVLGMKLDAESHELTLSAMRYLAVLR
KLFKATFKGKASTKKAVLKFLQHNYELMNEML*

IP10581.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18091-PA 331 GF18091-PA 6..331 7..332 693 46.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17087-PA 336 GG17087-PA 1..336 1..332 1457 82.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19200-PA 342 GH19200-PA 1..342 1..331 473 35.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG14383-PA 332 CG14383-PA 1..332 1..332 1721 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24233-PA 349 GI24233-PA 1..342 1..325 514 37.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23152-PA 323 GL23152-PA 3..323 7..332 542 39.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12947-PA 323 GA12947-PA 3..323 7..332 528 38.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25970-PA 332 GM25970-PA 1..332 1..332 1624 91 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20530-PA 332 GD20530-PA 1..332 1..332 1650 92.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10806-PA 342 GJ10806-PA 1..342 1..332 603 40.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19169-PA 348 GK19169-PA 6..348 5..331 533 37.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24477-PA 336 GE24477-PA 1..336 1..332 1434 81.2 Plus