Clone IP10585 Report

Search the DGRC for IP10585

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:105
Well:85
Vector:pOT2
Associated Gene/TranscriptCG14511-RA
Protein status:IP10585.pep: gold
Preliminary Size:969
Sequenced Size:1234

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14511 2005-01-01 Successful iPCR screen
CG14511 2008-04-29 Release 5.5 accounting
CG14511 2008-08-15 Release 5.9 accounting
CG14511 2008-12-18 5.12 accounting

Clone Sequence Records

IP10585.complete Sequence

1234 bp (1234 high quality bases) assembled on 2006-07-25

GenBank Submission: BT028789

> IP10585.complete
CCGAAGAGAAAGTAAGTTGGCTTAAAAGCTCGTCATGGCCCAGATCGTAG
GTTAAAGTTGGTGGGAATCGTCTACTTTCGTTGCGCGAGTTCATGAATTT
ATCCATCCGCGCTATTTCGGCCATCTGCGGCGTTTTCTTGGGCTGCTGCA
GTGGCGTCGTCTTCTTGGAGCTCCTGGTTAAACTGGATCCCGGCGCTGGA
AACCTTATAACTGGCGCCCAGTTTGCATTTATTGCCCTCGAGGGCTTCAT
CTTCACCTCGAAGTTTGGCCTGGCCCAGAGAGTGATCAGCCTGCGCGACT
ATGCGCTCCTCGTGGCCATGTTTTTCCTGACCAGCGTATGCAACAACTAC
GTGTTCAAGTTCAAAGTTCCAATGACACTGCACATGATCATACGCGGCGG
TTCGCTGATCTCCAACATGTGCCTGTGCACGTTGATCCTGAAGAGGAGTT
ACCGGTTGAGTCAGTACATATCGGTGCTCATGATCAGCGTGGGCATTTTC
GTCTGCACATATTTCTCCAGTCCGGATTTGGTGGGTAAGATGGAGAATTT
GGATAGTGGCGCCGAGGCGGATACGTTCTGGTGGCTGTTGGGCGTGGCAC
TCTTGGTGCTGGCTCTATTTGTTTCCTCCTACATGGGAATTACACAGGAG
TTGCTGTATCGACGTCATGGCAAGTGCGCCAGGGAAGCGTTGTATTACAC
CCACCTGTTGCCGCTGCCCGCCTTCCTGCTCATGCATGACGACATACGGA
CGCACTGGCTTTTGGCGTTCACGGGCGAGTCCTACCAGTTGCCCCTCCTG
GGCGTGGCAGTGCCCCTAATCCTGCTATACTTATTGGGCAACGTGCTTGC
GCAGCATTTGTGCATCAGCTCCGTTTACACCCTGACCACGGAGTGCAGCT
CGCTGACGGTGACTCTGATCCTCACACTCCGCAAGTTCATCTCGCTGGTC
TTTTCGATCGTATACTTCCGAAATCCCTTCACCTGGTGGCACTGGCTGGG
CACCGCGCTAGTCTTTGTGGGCACCTTGATGTTTGCAAATGTGATCAGAG
TTCCGAAATGAAAAAACCAGGCTGTGAAACAGGAATAGGCTTTCCAAAAC
TTTTTTGTGACGAACAATGTTATAATTCCATTTACATTTACAATTACATT
TAAGTACAAATTAAAATTACAAGACTCATAATTGTTATGAAAAGAAGGCA
TACATTAAAAGTAATGAAAAAAAAAAAAAAAAAA

IP10585.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14511-RA 1216 CG14511-RA 1..1216 1..1216 6080 100 Plus
CG14516.b 3342 CG14516.b 3222..3342 1221..1101 605 100 Minus
CG14516-RB 3413 CG14516-RB 3293..3413 1221..1101 605 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:36:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24968551..24969759 1216..1 5895 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:02:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:36:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29145673..29146893 1221..1 6105 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28886504..28887724 1221..1 6105 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:36:39 has no hits.

IP10585.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:37:44 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24968551..24969759 1..1216 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:46:27 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
CG14511-RA 1..969 93..1061 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:21:14 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
CG14511-RA 1..969 93..1061 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:50:57 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
CG14511-RA 1..969 93..1061 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:39:31 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
CG14511-RA 1..969 93..1061 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:14:55 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
CG14511-RA 1..969 93..1061 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:49:48 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
CG14511-RA 1..969 93..1061 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:21:14 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
CG14511-RA 1..1216 1..1216 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:50:57 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
CG14511-RA 1..1216 1..1216 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:39:32 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
CG14511-RA 1..969 93..1061 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:14:55 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
CG14511-RA 1..1216 1..1216 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:37:44 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29145678..29146893 1..1216 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:37:44 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29145678..29146893 1..1216 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:37:44 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29145678..29146893 1..1216 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:50:57 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24971400..24972615 1..1216 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:50:02 Download gff for IP10585.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28886509..28887724 1..1216 100   Minus

IP10585.hyp Sequence

Translation from 92 to 1060

> IP10585.hyp
MNLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
GFIFTSKFGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFKVPMTLHMII
RGGSLISNMCLCTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKM
ENLDSGAEADTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMHDDIRTHWLLAFTGESYQLPLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIVYFRNPFTWWH
WLGTALVFVGTLMFANVIRVPK*

IP10585.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14511-PA 322 CG14511-PA 1..322 1..322 1660 100 Plus
Efr-PB 352 CG3774-PB 1..325 1..318 936 54.9 Plus
Efr-PA 352 CG3774-PA 1..325 1..318 936 54.9 Plus

IP10585.pep Sequence

Translation from 92 to 1060

> IP10585.pep
MNLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
GFIFTSKFGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFKVPMTLHMII
RGGSLISNMCLCTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKM
ENLDSGAEADTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMHDDIRTHWLLAFTGESYQLPLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIVYFRNPFTWWH
WLGTALVFVGTLMFANVIRVPK*

IP10585.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:57:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22938-PA 328 GF22938-PA 1..319 1..322 1378 83.2 Plus
Dana\GF20373-PA 353 GF20373-PA 1..329 1..322 935 54.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12035-PA 331 GG12035-PA 1..322 1..322 1502 93.5 Plus
Dere\GG19573-PA 352 GG19573-PA 1..326 1..319 935 55 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13938-PA 331 GH13938-PA 1..316 3..317 1180 78.2 Plus
Dgri\GH24120-PA 344 GH24120-PA 1..324 5..322 937 56.3 Plus
Dgri\GH24121-PA 352 GH24121-PA 1..324 1..318 918 55 Plus
Dgri\GH18667-PA 349 GH18667-PA 1..323 3..317 843 51.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG14511-PA 322 CG14511-PA 1..322 1..322 1660 100 Plus
Efr-PB 352 CG3774-PB 1..325 1..318 936 54.9 Plus
Efr-PA 352 CG3774-PA 1..325 1..318 936 54.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24838-PA 332 GI24838-PA 1..320 3..321 1177 75.3 Plus
Dmoj\GI16379-PA 346 GI16379-PA 1..327 1..319 958 56.7 Plus
Dmoj\GI16380-PA 349 GI16380-PA 1..327 1..319 943 56.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23603-PA 332 GL23603-PA 1..321 1..321 1342 81.3 Plus
Dper\GL21309-PA 350 GL21309-PA 1..326 1..319 913 54.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13042-PA 332 GA13042-PA 1..321 1..321 1343 81.3 Plus
Dpse\GA17679-PA 350 GA17679-PA 1..326 1..319 912 54.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12260-PA 331 GM12260-PA 1..322 1..322 1617 96.6 Plus
Dsec\GM12467-PA 223 GM12467-PA 1..197 130..319 534 53.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16786-PA 352 GD16786-PA 1..326 1..319 927 54.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24481-PA 332 GJ24481-PA 1..316 3..318 1212 78.9 Plus
Dvir\GJ16752-PA 351 GJ16752-PA 1..325 1..319 955 56.3 Plus
Dvir\GJ19145-PA 351 GJ19145-PA 1..325 1..319 942 55.7 Plus
Dvir\GJ14214-PA 349 GJ14214-PA 3..324 4..318 912 55.9 Plus
Dvir\GJ14584-PA 144 GJ14584-PA 1..119 205..319 363 60.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19180-PA 323 GK19180-PA 3..319 2..322 1224 76 Plus
Dwil\GK15384-PA 348 GK15384-PA 1..320 1..318 903 52.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10473-PA 331 GE10473-PA 1..322 1..322 1539 94.4 Plus
Dyak\GE16733-PA 352 GE16733-PA 1..326 1..319 929 54.7 Plus