Clone IP10611 Report

Search the DGRC for IP10611

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:106
Well:11
Vector:pOT2
Associated Gene/TranscriptCG10651-RA
Protein status:IP10611.pep: gold
Preliminary Size:951
Sequenced Size:1065

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10651 2005-01-01 Successful iPCR screen
CG10651 2008-04-29 Release 5.5 accounting
CG10651 2008-08-15 Release 5.9 accounting
CG10651 2008-12-18 5.12 accounting

Clone Sequence Records

IP10611.complete Sequence

1065 bp (1065 high quality bases) assembled on 2006-01-24

GenBank Submission: BT024329

> IP10611.complete
CACAACTCTGGTTATTTATGCCATGATAAAGTGCATCTGGCTGCTGTTCT
CCACATTATATATTCAAGATACAGGCGCTTCAGATAAATGGTGCAAAGCT
GACCTGTGCCGAGGACAACACGTGCTCTGCGATGACAATGGAAATTTTGA
ATCCACTTGTCCCAAACAAGCCGCAGCCATGGTGAAAATGAGCTGGGATA
TGATAGCCCTCATCGTGGACAAGCACAATGAATATCGCAACAAGTTCGCC
GGCGGAATGGATCAGAATCCGAAGGCGGCAAGGATGACCACGATCGAATG
GGATCCGGAACTGGCCAAAGTGGCCGACGGTCTGGTACGTCGTTGTGAGC
CAATCCGAGATCAGTGCGCCATAACCCCAAATTACGGTCATGCGGAAGTC
AGCTATTCGCTGGAAAAGTACTTCTGCATGACCACGAAAAAGGAGGCCCT
GAGGAAGCAACTCGATCACTGGTTTGACCCCAATAGTAAAGATGAAGTGC
AGAAGCTGTTCTTCTCATGGACTAAAAATCAGCAGGAACTGTCCAAAAAC
TACTTTCAGGTATTGAGGGATCGAGCTAATCGCGTGGGCTGCGCCATAGT
TGAGTATGTTCGGCCAGCACTGGTCCACCAGTTGCTAAAGTGCGTCTACA
ACTGCGGAGTGAGTCTCTGTGAGGAGGAGGATAATCCCGTCTACGAGGAC
ACCGACGAAGAAGCCGCTTCAGAGTGCATGAAGGGAAGCAATAAGCAATA
CAAGAATCTTTGCCACAAAGATGAGCTCGTGAAGACCTGCAATGGTGGCT
CACTTTTCGTCGAACCTGAAAATGATTATAACGATGGTCAAGAAGAGAAT
ATGGAAAACGATTATGAATTCGAGACCACCGTGTTCACACTTCCAACGTA
CGATCCAAACGATGTGTTGCCAACGCTACCAGACAACCCAGATTTAAATT
TCAATACAATAGTTAAGGACTAGGATCGGGAATAAACAAGTTATTGAAAA
GTTTTGACCCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAA

IP10611.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG10651-RA 1156 CG10651-RA 121..1139 1..1019 5080 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20132194..20132670 1011..535 2385 100 Minus
chr2L 23010047 chr2L 20132720..20133112 535..143 1935 99.5 Minus
chr2L 23010047 chr2L 20133171..20133312 142..1 710 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:02:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20133797..20134281 1019..535 2410 99.8 Minus
2L 23513712 2L 20134331..20134723 535..143 1965 100 Minus
2L 23513712 2L 20134782..20134923 142..1 710 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20133797..20134281 1019..535 2410 99.7 Minus
2L 23513712 2L 20134331..20134723 535..143 1965 100 Minus
2L 23513712 2L 20134782..20134923 142..1 710 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:40:47 has no hits.

IP10611.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:41:37 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20133171..20133312 1..142 100   Minus
chr2L 20132194..20132670 535..1011 100 <- Minus
chr2L 20132721..20133112 143..534 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:46:29 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
CG10651-RA 1..951 23..973 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:35:39 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
CG10651-RA 1..951 23..973 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:51:19 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
CG10651-RA 1..951 23..973 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:10:20 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
CG10651-RA 1..951 23..973 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:51:48 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
CG10651-RA 1..951 23..973 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:07:08 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
CG10651-RA 1..951 23..973 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:35:39 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
CG10651-RA 1..1011 1..1011 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:51:19 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
CG10651-RA 1..1011 1..1011 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:10:20 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
CG10651-RA 1..951 23..973 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:51:48 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
CG10651-RA 1..1011 1..1011 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:41:37 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20133805..20134281 535..1011 100 <- Minus
2L 20134332..20134723 143..534 100 <- Minus
2L 20134782..20134923 1..142 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:41:37 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20133805..20134281 535..1011 100 <- Minus
2L 20134332..20134723 143..534 100 <- Minus
2L 20134782..20134923 1..142 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:41:37 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20133805..20134281 535..1011 100 <- Minus
2L 20134332..20134723 143..534 100 <- Minus
2L 20134782..20134923 1..142 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:51:19 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20133805..20134281 535..1011 100 <- Minus
arm_2L 20134332..20134723 143..534 100 <- Minus
arm_2L 20134782..20134923 1..142 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:59:23 Download gff for IP10611.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20133805..20134281 535..1011 100 <- Minus
2L 20134332..20134723 143..534 100 <- Minus
2L 20134782..20134923 1..142 100   Minus

IP10611.hyp Sequence

Translation from 0 to 972

> IP10611.hyp
TTLVIYAMIKCIWLLFSTLYIQDTGASDKWCKADLCRGQHVLCDDNGNFE
STCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEW
DPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYSLEKYFCMTTKKEAL
RKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANRVGCAIV
EYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQY
KNLCHKDELVKTCNGGSLFVEPENDYNDGQEENMENDYEFETTVFTLPTY
DPNDVLPTLPDNPDLNFNTIVKD*

IP10611.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:29:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG10651-PB 316 CG10651-PB 1..316 8..323 1736 100 Plus
CG10651-PA 316 CG10651-PA 1..316 8..323 1736 100 Plus
CG34002-PB 350 CG34002-PB 9..266 1..269 262 28.4 Plus
CG32679-PA 254 CG32679-PA 8..246 12..259 259 30.8 Plus
scpr-B-PA 262 CG17210-PA 3..249 9..259 245 29.2 Plus

IP10611.pep Sequence

Translation from 22 to 972

> IP10611.pep
MIKCIWLLFSTLYIQDTGASDKWCKADLCRGQHVLCDDNGNFESTCPKQA
AAMVKMSWDMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKV
ADGLVRRCEPIRDQCAITPNYGHAEVSYSLEKYFCMTTKKEALRKQLDHW
FDPNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANRVGCAIVEYVRPAL
VHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLCHKD
ELVKTCNGGSLFVEPENDYNDGQEENMENDYEFETTVFTLPTYDPNDVLP
TLPDNPDLNFNTIVKD*

IP10611.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15450-PA 238 GF15450-PA 1..202 8..260 549 44.3 Plus
Dana\GF20496-PA 256 GF20496-PA 25..249 19..252 249 29.2 Plus
Dana\GF21598-PA 255 GF21598-PA 5..248 8..251 244 28.8 Plus
Dana\GF12004-PA 289 GF12004-PA 24..282 23..255 224 26.5 Plus
Dana\GF12998-PA 288 GF12998-PA 23..243 21..251 217 28.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21583-PA 313 GG21583-PA 1..312 1..309 1399 80.8 Plus
Dere\GG18928-PA 253 GG18928-PA 5..245 2..252 246 31.8 Plus
Dere\GG13638-PA 314 GG13638-PA 42..266 33..262 245 26.2 Plus
Dere\GG19450-PA 288 GG19450-PA 55..281 23..251 242 29.2 Plus
Dere\GG19449-PA 256 GG19449-PA 6..247 7..251 240 29.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12878-PA 260 GH12878-PA 27..252 20..252 244 29.5 Plus
Dgri\GH18802-PA 260 GH18802-PA 19..247 23..252 220 28.4 Plus
Dgri\GH12214-PA 256 GH12214-PA 22..248 23..252 214 29.3 Plus
Dgri\GH24697-PA 274 GH24697-PA 17..261 1..247 211 26.2 Plus
Dgri\GH17451-PA 253 GH17451-PA 4..249 7..251 208 27 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG10651-PB 316 CG10651-PB 1..316 1..316 1736 100 Plus
CG10651-PA 316 CG10651-PA 1..316 1..316 1736 100 Plus
CG34002-PB 350 CG34002-PB 32..266 22..262 261 29.2 Plus
CG32679-PA 254 CG32679-PA 8..246 5..252 259 30.8 Plus
scpr-B-PA 262 CG17210-PA 3..249 2..252 245 29.2 Plus
Ag5r2-PA 254 CG9540-PA 21..247 23..251 233 28.3 Plus
scpr-C-PB 262 CG5106-PB 3..249 2..252 232 28.4 Plus
scpr-C-PA 262 CG5106-PA 3..249 2..252 232 28.4 Plus
scpr-A-PA 264 CG5207-PA 23..251 23..252 229 28.4 Plus
Ag5r-PC 256 CG9538-PC 6..247 7..251 228 28.9 Plus
Ag5r-PB 256 CG9538-PB 6..247 7..251 228 28.9 Plus
Ag5r-PA 256 CG9538-PA 6..247 7..251 228 28.9 Plus
CG42564-PA 500 CG10284-PA 55..282 23..252 211 28.4 Plus
CG3640-PA 296 CG3640-PA 29..248 21..251 207 27.4 Plus
CG30486-PA 263 CG30486-PA 1..252 1..253 198 26.1 Plus
CG6628-PA 277 CG6628-PA 25..258 17..251 191 26.8 Plus
CG42780-PA 253 CG42780-PA 19..252 20..249 187 26.4 Plus
CG9400-PA 308 CG9400-PA 35..281 8..247 185 25.8 Plus
CG9822-PA 263 CG9822-PA 26..250 23..247 178 27.8 Plus
CG8072-PA 247 CG8072-PA 10..240 8..247 159 25.2 Plus
CG17974-PA 259 CG17974-PA 13..254 7..252 152 27.2 Plus
antr-PB 272 CG30488-PB 22..266 21..271 152 24.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20220-PA 283 GI20220-PA 26..271 23..252 238 27.7 Plus
Dmoj\GI23890-PA 260 GI23890-PA 3..247 5..252 228 28.5 Plus
Dmoj\GI15745-PA 257 GI15745-PA 15..248 16..252 227 26.6 Plus
Dmoj\Tes33-PA 265 GI23699-PA 6..252 4..252 226 27.2 Plus
Dmoj\GI15744-PA 256 GI15744-PA 4..253 2..252 216 30.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10234-PA 289 GL10234-PA 16..250 5..251 251 28.9 Plus
Dper\GL10101-PA 316 GL10101-PA 45..272 23..256 243 29 Plus
Dper\GL20409-PA 257 GL20409-PA 6..249 1..252 237 28.1 Plus
Dper\GL12570-PA 261 GL12570-PA 20..248 23..252 233 30.7 Plus
Dper\GL12032-PA 261 GL12032-PA 20..248 23..252 233 30.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25557-PA 397 GA25557-PA 3..250 6..256 428 34.5 Plus
Dpse\GA28791-PA 352 GA28791-PA 3..187 6..192 299 34 Plus
Dpse\GA23354-PA 263 GA23354-PA 19..254 5..251 261 31.5 Plus
Dpse\GA17580-PA 289 GA17580-PA 31..250 21..251 254 29.5 Plus
Dpse\GA17580-PB 328 GA17580-PB 70..289 21..251 254 29.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23336-PA 368 GM23336-PA 99..367 41..309 1392 94.8 Plus
Dsec\GM11319-PA 237 GM11319-PA 8..229 22..252 254 32.3 Plus
Dsec\GM25724-PA 332 GM25724-PA 48..244 62..262 246 29.9 Plus
Dsec\GM12039-PA 256 GM12039-PA 6..247 7..251 238 29.3 Plus
Dsec\GM12040-PA 254 GM12040-PA 18..247 20..251 236 28.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11960-PA 232 GD11960-PA 1..231 79..309 1200 95.7 Plus
Dsim\GD16039-PA 254 GD16039-PA 8..246 5..252 260 31.7 Plus
Dsim\GD10825-PA 239 GD10825-PA 1..196 63..262 259 30.5 Plus
Dsim\GD14731-PA 328 GD14731-PA 48..244 62..262 241 29.4 Plus
Dsim\GD18744-PA 277 GD18744-PA 12..251 12..252 226 28.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23982-PA 265 GJ23982-PA 8..252 6..252 231 28.2 Plus
Dvir\GJ23420-PA 260 GJ23420-PA 19..247 23..252 230 29.8 Plus
Dvir\GJ18491-PA 324 GJ18491-PA 75..315 5..251 228 28.7 Plus
Dvir\GJ21118-PA 308 GJ21118-PA 45..259 33..250 227 29.3 Plus
Dvir\GJ23256-PA 260 GJ23256-PA 19..247 23..252 221 28.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24140-PA 320 GK24140-PA 13..255 16..257 422 36.8 Plus
Dwil\GK25699-PA 253 GK25699-PA 1..244 1..251 264 31.2 Plus
Dwil\GK15903-PA 518 GK15903-PA 26..259 23..258 250 28.9 Plus
Dwil\GK14719-PA 256 GK14719-PA 24..249 24..251 238 29.3 Plus
Dwil\GK21877-PA 232 GK21877-PA 19..207 60..251 234 29.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12603-PA 312 GE12603-PA 1..311 1..309 1418 83 Plus
Dyak\GE15398-PA 253 GE15398-PA 21..245 19..252 258 31.6 Plus
Dyak\GE15100-PA 390 GE15100-PA 42..266 33..262 254 26.7 Plus
Dyak\Ag5r-PA 256 GE16102-PA 6..247 7..251 236 28.9 Plus
Dyak\GE16103-PA 283 GE16103-PA 51..276 24..251 236 28.9 Plus