Clone IP10645 Report

Search the DGRC for IP10645

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:106
Well:45
Vector:pOT2
Associated Gene/TranscriptCG13054-RA
Protein status:IP10645.pep: gold
Preliminary Size:945
Sequenced Size:1357

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13054 2005-01-01 Successful iPCR screen
CG13054 2008-04-29 Release 5.5 accounting
CG13054 2008-08-15 Release 5.9 accounting
CG13054 2008-12-18 5.12 accounting

Clone Sequence Records

IP10645.complete Sequence

1357 bp (1357 high quality bases) assembled on 2005-02-26

GenBank Submission: BT023271

> IP10645.complete
AGACATCAACGGTTCGCGTTATCCTGAAACAAGTTCCCTTGGAAAGCAAA
CTAAACTGAAAGCCAGAACACGAACTGAATTACTGTGCCAGTGCAAAAAG
AGTGAACTAAGTGAACTAATATTCTGAAAAATTGAGATAAAATTCAAACT
TACGCCATGGATACTCTGTCACCCAATAATGGCTCTAAGTCGAGCTCCAG
CGGCAGTTCGGCGGCCAGTTCCTCCATGGATCTCGGCAAGCAGCAGCAGA
AGGAGAAGTTTCATCGTCACCCAAGGAATGGGCCCAAGAAGCTTTCCCGC
TCCAGGAGTTTGCTGCAATTGCTCAGCAGGCACCTGGGCAGGCACTTCCA
CCACCAGAACCAGCAGAACGACACGGTCTACAGCAGCCAGGATGATATTA
GGAGCAGCTCAACGGATTCCTTCAGCTTGAGCTACGAGCGTGGCAGCCAC
GAGTGCCCTATCAATGGTTCCTCCCTGGACCTGGAGCACACATCCCGGAC
CTCGAGCGGATCGGCCTGCTCCAGATACTCGCCCGGTCTGGATTACTACG
ATCAGCAGGGACACATCTATGTGGAGGCTGTCTACAGACCCGGCAGTGCC
ATGGAGCAACTGCATCCGCAGCTGCACTTCGAGGAAGACACCAGCGAGGA
GGGTAGCAGCAACGAGGCGGAGGACGAGGTGGAGCTGCGCCACGACGAGA
ACGAGAACGAGAACAGCAAGCCTCGATCCGCATCAGCCGCTTCCGCCAAG
TCATCGGGACTGCATCTCAGCCGAATTTCCATCTCCTCCTCGGTGAGCCG
CATCCTGCATCACTTCTCCAGTCCGACGGGAAATGCATCGATGCGCTCGT
TGTCCTGCAGCAGCACTCCACTGCGTCAGCCCAAGAAATCCCTGTCGCCG
AACAACTCGAACAACAGCAGCAGCAGCAGCTCCAGCTCCAAATTCTCCCG
TGCTCCCGCCTCCAAGAAGGAGGATAAGAAGCAGCAGAGCATCCTGCGAC
CGCCAGTCCAGTACGTCTACATGAAGGGCATGTCGGGACTGTATTCCCGA
GTGCCCAGCTATGCGGTCTGCTATCCGTATACCCTACAGCACATGTACTA
AAACATGTCCTGGGACACCATAAAATGGATGGAAAGCTGCAAGCTGGTTG
GGGGTCTTGAACAATATACTTAGGAATTTTCTAGTGATGTACGAGTAGTG
CCTGAAATCCAGAGATTTGAGTAGAGGGAGAGAGTAGTGGGAAGATAGGG
GCATAGGACAAAAAGCAGCATATTTTATAAATGTGTCCAAGCTGAGTTCG
CAAACCCAATAAGTGTACCTAAAGACAAGCCCAGAAAATCAAAAAAAAAA
AAAAAAA

IP10645.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13054-RA 1352 CG13054-RA 1..1352 1..1352 6760 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16245529..16246868 1340..1 6640 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:02:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16255840..16257191 1352..1 6760 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16248940..16250291 1352..1 6760 100 Minus
Blast to na_te.dros performed 2019-03-16 07:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6740..6822 855..940 143 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6868 858..1009 142 60.1 Plus
roo 9092 roo DM_ROO 9092bp 1067..1153 855..941 137 64.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6830..6871 900..941 129 78.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2329..2368 901..940 119 77.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2332..2371 901..940 119 77.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2335..2374 901..940 119 77.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2355..2430 855..936 116 65.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2393 858..941 113 62.4 Plus

IP10645.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:02:26 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16245529..16246868 1..1340 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:46:39 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
CG13054-RA 1..945 157..1101 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:11:05 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
CG13054-RA 1..945 157..1101 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:05:49 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
CG13054-RA 1..945 157..1101 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:55:46 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
CG13054-RA 1..945 157..1101 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:25:19 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
CG13054-RA 1..945 157..1101 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:04:47 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
CG13054-RA 1..1340 1..1340 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:11:05 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
CG13054-RA 1..1340 1..1340 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:05:49 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
CG13054-RA 1..1340 1..1340 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:55:47 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
CG13054-RA 1..1340 1..1340 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:25:19 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
CG13054-RA 1..1340 1..1340 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:02:26 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16255852..16257191 1..1340 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:02:26 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16255852..16257191 1..1340 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:02:26 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16255852..16257191 1..1340 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:05:49 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16248952..16250291 1..1340 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:30:59 Download gff for IP10645.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16248952..16250291 1..1340 100   Minus

IP10645.pep Sequence

Translation from 156 to 1100

> IP10645.pep
MDTLSPNNGSKSSSSGSSAASSSMDLGKQQQKEKFHRHPRNGPKKLSRSR
SLLQLLSRHLGRHFHHQNQQNDTVYSSQDDIRSSSTDSFSLSYERGSHEC
PINGSSLDLEHTSRTSSGSACSRYSPGLDYYDQQGHIYVEAVYRPGSAME
QLHPQLHFEEDTSEEGSSNEAEDEVELRHDENENENSKPRSASAASAKSS
GLHLSRISISSSVSRILHHFSSPTGNASMRSLSCSSTPLRQPKKSLSPNN
SNNSSSSSSSSKFSRAPASKKEDKKQQSILRPPVQYVYMKGMSGLYSRVP
SYAVCYPYTLQHMY*

IP10645.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10311-PA 316 GF10311-PA 1..316 1..314 1015 84.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13485-PA 312 GG13485-PA 1..312 1..314 1578 98.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:51:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15622-PA 330 GH15622-PA 1..330 1..314 480 55.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG13054-PA 314 CG13054-PA 1..314 1..314 1620 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12670-PA 364 GI12670-PA 1..364 1..314 579 55.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:51:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18025-PA 365 GL18025-PA 1..365 1..314 623 63.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:51:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12006-PA 381 GA12006-PA 1..381 1..314 611 60.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:51:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24435-PA 314 GM24435-PA 1..314 1..314 1595 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:52:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12502-PA 164 GD12502-PA 1..164 149..314 819 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:52:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12650-PA 229 GJ12650-PA 1..96 1..95 243 64.4 Plus
Dvir\GJ12650-PA 229 GJ12650-PA 63..229 178..314 240 47.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:52:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17650-PA 304 GK17650-PA 1..304 1..314 643 64.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:52:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22578-PA 312 GE22578-PA 1..312 1..314 1245 96.5 Plus
Dyak\GE22806-PA 86 GE22806-PA 1..86 229..314 326 95.3 Plus

IP10645.hyp Sequence

Translation from 156 to 1100

> IP10645.hyp
MDTLSPNNGSKSSSSGSSAASSSMDLGKQQQKEKFHRHPRNGPKKLSRSR
SLLQLLSRHLGRHFHHQNQQNDTVYSSQDDIRSSSTDSFSLSYERGSHEC
PINGSSLDLEHTSRTSSGSACSRYSPGLDYYDQQGHIYVEAVYRPGSAME
QLHPQLHFEEDTSEEGSSNEAEDEVELRHDENENENSKPRSASAASAKSS
GLHLSRISISSSVSRILHHFSSPTGNASMRSLSCSSTPLRQPKKSLSPNN
SNNSSSSSSSSKFSRAPASKKEDKKQQSILRPPVQYVYMKGMSGLYSRVP
SYAVCYPYTLQHMY*

IP10645.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13054-PA 314 CG13054-PA 1..314 1..314 1620 100 Plus