Clone IP10696 Report

Search the DGRC for IP10696

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:106
Well:96
Vector:pOT2
Associated Gene/TranscriptCheB42c-RA
Protein status:IP10696.pep: wuzgold
Preliminary Size:1092
Sequenced Size:690

Clone Sequence Records

IP10696.complete Sequence

690 bp assembled on 2009-02-12

GenBank Submission: BT058100.1

> IP10696.complete
AGAACTCTCATGCTGTTCGTATTTGGCTTTGCTAGTTCCTGGGCCGCAGA
CTACGAGCTGTTGCTGGAGGACCCTGATATCTTTTCACCCTGCACTGAAC
CGCCGCCGGGATCGATTGGATTCCACGATGCCTTCGATATTGGCGATCTG
GTAGTCGACCAGGACATGGACATCATTCACCTGTCCGAGAGTGTCACCTC
AATCTGGGATGTGGAGCCCACAGATCGCATATCCGCCAGGTTTGCAATAA
TGCATTACAACCGCGGCAGCTGGGAACCGACTGTATTTAGCATGGCCACG
CCGGACTTCTGCGCCTCAATGTTTGATGAGAATCAGTCGTGGTTTAAGTA
CTGGACCAAACACATTTCGAACCGCGATGAGGTGATGGAGAAGTGTTTTA
AAACGCGTGGTACCGTTATAATGCACAATCCATTCGATCTGCAGCTGCGT
CTAACGGACATTCGTGGTGCAACTCTCAGGGGTCGTTACAAAGCTGTGGT
CACCTTTGAGGCGGTCGATGAGAAGGATGTGCCACGCCGTAATTCCATTT
GCTTCGAAATCAGGGGAGAGGCCGAGAAGATAAATTAATTAAGGGCTTAA
TCTGTTCAAGGCGCGATATCAGTAACCTAAAAAACAATATAAACCCAATA
TCTACATATTTTGAAAATAAAAAAAAAAAAAAAAAAAAAA

IP10696.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
CheB42c-RA 671 CheB42c-RA 4..671 1..668 3340 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2831999..2832255 668..412 1285 100 Minus
chr2R 21145070 chr2R 2832558..2832792 235..1 1160 99.6 Minus
chr2R 21145070 chr2R 2832326..2832502 411..235 885 100 Minus
chr2L 23010047 chr2L 20818954..20819049 354..259 180 79.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:02:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6944609..6944870 673..412 1310 100 Minus
2R 25286936 2R 6945173..6945407 235..1 1175 100 Minus
2R 25286936 2R 6944941..6945117 411..235 885 100 Minus
2L 23513712 2L 20820449..20820544 354..259 180 79.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6945808..6946069 673..412 1310 100 Minus
2R 25260384 2R 6946372..6946606 235..1 1175 100 Minus
2R 25260384 2R 6946140..6946316 411..235 885 100 Minus
2R 25260384 2R 6944761..6944859 356..258 165 77.7 Minus
Blast to na_te.dros performed on 2019-03-16 06:53:54 has no hits.

IP10696.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:54:52 Download gff for IP10696.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2831999..2832255 412..668 100 <- Minus
chr2R 2832326..2832502 235..411 100 <- Minus
chr2R 2832559..2832792 1..234 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:36 Download gff for IP10696.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42c-RA 1..579 10..588 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:40 Download gff for IP10696.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42c-RA 1..579 10..588 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:20:32 Download gff for IP10696.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42c-RB 4..591 1..588 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:25:09 Download gff for IP10696.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42c-RB 4..591 1..588 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-12 19:02:17 Download gff for IP10696.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42c-RA 1..579 10..588 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:39 Download gff for IP10696.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42c-RA 1..668 1..668 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:20:32 Download gff for IP10696.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42c-RB 982..1649 1..668 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:25:09 Download gff for IP10696.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42c-RB 982..1649 1..668 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:54:52 Download gff for IP10696.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6945174..6945407 1..234 100   Minus
2R 6944614..6944870 412..668 100 <- Minus
2R 6944941..6945117 235..411 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:54:52 Download gff for IP10696.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6945174..6945407 1..234 100   Minus
2R 6944614..6944870 412..668 100 <- Minus
2R 6944941..6945117 235..411 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:54:52 Download gff for IP10696.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6945174..6945407 1..234 100   Minus
2R 6944614..6944870 412..668 100 <- Minus
2R 6944941..6945117 235..411 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:20:32 Download gff for IP10696.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2832119..2832375 412..668 100 <- Minus
arm_2R 2832446..2832622 235..411 100 <- Minus
arm_2R 2832679..2832912 1..234 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:08:02 Download gff for IP10696.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6945813..6946069 412..668 100 <- Minus
2R 6946140..6946316 235..411 100 <- Minus
2R 6946373..6946606 1..234 100   Minus

IP10696.hyp Sequence

Translation from 0 to 587

> IP10696.hyp
RTLMLFVFGFASSWAADYELLLEDPDIFSPCTEPPPGSIGFHDAFDIGDL
VVDQDMDIIHLSESVTSIWDVEPTDRISARFAIMHYNRGSWEPTVFSMAT
PDFCASMFDENQSWFKYWTKHISNRDEVMEKCFKTRGTVIMHNPFDLQLR
LTDIRGATLRGRYKAVVTFEAVDEKDVPRRNSICFEIRGEAEKIN*

IP10696.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
CheB42c-PB 196 CG33350-PB 2..196 1..195 1049 100 Plus
CheB42b-PA 196 CG33351-PA 4..195 3..194 633 56.8 Plus
CheB38c-PA 198 CG14405-PA 4..196 2..194 587 51.3 Plus
CheB38a-PA 197 CG33320-PA 13..196 11..194 520 47.8 Plus
CheB38b-PA 197 CG33321-PA 3..196 1..194 509 44.8 Plus

IP10696.pep Sequence

Translation from 0 to 587

> IP10696.pep
RTLMLFVFGFASSWAADYELLLEDPDIFSPCTEPPPGSIGFHDAFDIGDL
VVDQDMDIIHLSESVTSIWDVEPTDRISARFAIMHYNRGSWEPTVFSMAT
PDFCASMFDENQSWFKYWTKHISNRDEVMEKCFKTRGTVIMHNPFDLQLR
LTDIRGATLRGRYKAVVTFEAVDEKDVPRRNSICFEIRGEAEKIN*

IP10696.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11757-PA 196 GF11757-PA 3..196 1..194 728 62.9 Plus
Dana\GF11760-PA 198 GF11760-PA 7..198 4..195 613 55.7 Plus
Dana\GF13150-PA 200 GF13150-PA 20..199 15..193 300 33.1 Plus
Dana\GF19949-PA 204 GF19949-PA 27..201 18..194 280 31.1 Plus
Dana\GF19882-PA 257 GF19882-PA 10..140 1..132 233 33.3 Plus
Dana\GF19882-PA 257 GF19882-PA 144..252 78..188 211 36.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10785-PA 196 GG10785-PA 2..196 1..195 955 88.2 Plus
Dere\GG10786-PA 196 GG10786-PA 3..195 2..194 653 60.1 Plus
Dere\GG21546-PA 198 GG21546-PA 5..196 3..194 543 47.9 Plus
Dere\GG21547-PA 197 GG21547-PA 3..196 1..194 524 46.4 Plus
Dere\GG15791-PA 202 GG15791-PA 11..201 3..194 400 37.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19860-PA 198 GH19860-PA 5..198 3..194 478 40.7 Plus
Dgri\GH19861-PA 1785 GH19861-PA 5..196 3..190 437 41.1 Plus
Dgri\GH11359-PA 200 GH11359-PA 11..200 3..194 361 35.4 Plus
Dgri\GH11360-PA 193 GH11360-PA 3..193 2..194 328 30.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
CheB42c-PB 196 CG33350-PB 2..196 1..195 1049 100 Plus
CheB42b-PA 196 CG33351-PA 4..195 3..194 633 56.8 Plus
CheB38c-PA 198 CG14405-PA 4..196 2..194 587 51.3 Plus
CheB38a-PA 197 CG33320-PA 13..196 11..194 520 47.8 Plus
CheB38b-PA 197 CG33321-PA 3..196 1..194 509 44.8 Plus
CheB74a-PA 202 CG33924-PA 11..201 3..194 393 37.8 Plus
CheB42a-PA 198 CG33348-PA 6..198 2..194 333 33.5 Plus
CheB53b-PA 204 CG33524-PA 14..200 3..193 333 34.4 Plus
CheB53a-PA 226 CG33550-PA 19..193 18..193 333 33.5 Plus
CheB98a-PB 197 CG14531-PB 7..195 3..194 309 31.8 Plus
CheB93a-PA 200 CG15503-PA 10..196 2..190 285 31.1 Plus
CheB93b-PA 203 CG31438-PA 23..203 13..194 282 32.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19808-PA 199 GI19808-PA 19..199 15..194 522 50.3 Plus
Dmoj\GI24073-PA 201 GI24073-PA 11..201 3..195 385 34.7 Plus
Dmoj\GI23608-PA 200 GI23608-PA 11..200 3..194 318 33.9 Plus
Dmoj\GI18506-PA 196 GI18506-PA 7..196 3..194 309 32.8 Plus
Dmoj\GI17737-PA 258 GI17737-PA 12..258 5..194 268 26.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10962-PA 197 GL10962-PA 3..197 1..195 672 60.5 Plus
Dper\GL27150-PA 201 GL27150-PA 10..201 1..194 402 38.1 Plus
Dper\GL13801-PA 200 GL13801-PA 11..200 4..194 399 38.2 Plus
Dper\GL11129-PA 202 GL11129-PA 20..202 13..194 363 38.6 Plus
Dper\GL27336-PA 199 GL27336-PA 19..197 13..193 355 38.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:03:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24546-PA 197 GA24546-PA 3..197 1..195 670 60.5 Plus
Dpse\GA16252-PA 201 GA16252-PA 10..201 1..194 407 38.7 Plus
Dpse\GA13057-PA 200 GA13057-PA 11..200 4..194 405 38.7 Plus
Dpse\GA24619-PA 202 GA24619-PA 20..202 13..194 369 39.7 Plus
Dpse\GA27041-PA 199 GA27041-PA 19..197 13..193 357 38.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:03:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20835-PA 196 GM20835-PA 2..196 1..195 1009 95.4 Plus
Dsec\GM20836-PA 196 GM20836-PA 4..196 3..195 653 58.5 Plus
Dsec\GM23304-PA 197 GM23304-PA 3..196 1..194 536 46.9 Plus
Dsec\GM23302-PA 166 GM23302-PA 4..164 2..194 458 43.5 Plus
Dsec\GM23303-PA 195 GM23303-PA 13..194 11..195 448 41.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:03:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10288-PA 196 GD10288-PA 2..196 1..195 1023 96.9 Plus
Dsim\GD10289-PA 196 GD10289-PA 4..196 3..195 669 59.6 Plus
Dsim\GD21678-PA 197 GD21678-PA 3..196 1..194 536 47.4 Plus
Dsim\GD21677-PA 198 GD21677-PA 13..197 11..195 522 46.5 Plus
Dsim\GD21676-PA 166 GD21676-PA 4..164 2..194 458 43.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:03:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18474-PA 199 GJ18474-PA 19..199 15..194 509 47.5 Plus
Dvir\GJ23996-PA 200 GJ23996-PA 11..200 3..194 385 37 Plus
Dvir\GJ23975-PA 200 GJ23975-PA 11..200 3..194 374 35.9 Plus
Dvir\GJ23997-PA 200 GJ23997-PA 11..200 3..194 371 36.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21541-PA 201 GK21541-PA 9..197 5..194 603 54.7 Plus
Dwil\GK12101-PA 208 GK12101-PA 8..199 3..193 394 39.4 Plus
Dwil\GK10987-PA 200 GK10987-PA 5..197 2..193 364 37.1 Plus
Dwil\GK18906-PA 203 GK18906-PA 19..198 15..193 280 31.5 Plus
Dwil\GK24357-PA 165 GK24357-PA 2..151 45..193 258 33.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:03:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24346-PA 196 GE24346-PA 2..196 1..195 975 91.3 Plus
Dyak\GE24356-PA 196 GE24356-PA 4..196 3..195 662 59.1 Plus
Dyak\GE13540-PA 197 GE13540-PA 4..197 2..195 572 51 Plus
Dyak\GE13541-PA 197 GE13541-PA 3..196 1..194 531 46.4 Plus
Dyak\GE22129-PA 201 GE22129-PA 11..201 3..194 378 39.9 Plus