Clone IP10721 Report

Search the DGRC for IP10721

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:107
Well:21
Vector:pOT2
Associated Gene/TranscriptCG11313-RC
Protein status:IP10721.pep: gold
Preliminary Size:1113
Sequenced Size:1244

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11313 2005-01-01 Successful iPCR screen
CG11313 2008-04-29 Release 5.5 accounting
CG11313 2008-08-15 Release 5.9 accounting
CG11313 2008-12-18 5.12 accounting

Clone Sequence Records

IP10721.complete Sequence

1244 bp (1244 high quality bases) assembled on 2005-05-04

GenBank Submission: BT023227

> IP10721.complete
GAATTCAGTCGCAAGCGCAATGAAGGTGATCGCAGCCGTTTTGCTGTGCT
TATTGATTATCCGCACGGCCCATGGACAGTACGTGAGTTGCCGGAATCCC
AACCAGCGGACTGGATATTGCGTGAACATCCCCTTGTGTGTGCCACTGAA
TTCCGTGCTGGCGAAGAGTAATCCTACAGACTCCGAGATGCGGTTCATCC
GAGAATCCCGTTGCCTCGTATCTGACCAGAGCGATCTGCCATTCGTCTGC
TGCACTCCGGATACGGACTACAACACGACGCGTGCTAGACCTAACGACGA
AGTGATACATTCCACTTTGCTTCCCGATCGGTCCATCTGTGGGGGCGATA
TAGCGTACAACCAGATCACGAAAGGCAACGAAACCGTTCTCACTGAATTC
GCCTGGATGGTGCTGTTAGAGTACCGTCCTCATGATGGACAACAATTGAG
AACGTACTGCGCGGGATCACTGATCAATAATCGATATGTTGTAACAGCGG
CTCACTGCGTGTCGGCTGCTACTAGGGCCCGCAAAGGAGATGTAGTCTCT
GTGAGATTGGGCGAGCATAACACCAGTGCCGTGGTGGATTGCCTCAATGG
AAGGTGCCTACCGGAACCTGTGCAAATCGCGGTCGAGGAGATCCGCATAC
ATGAAAGCTTCGGTACCCGATTGTTTTGGAACGACATTGCTCTGATCCGT
TTGGCGAGAGAGGTTGCCTATTCGCCCAGCATTCGACCTGTTTGCTTGCC
CTCGACTGTGGGTCTGCAAAACTGGCAATCCGGCCAGGCGTTTACCGTGG
CAGGATGGGGTAGAACCCTCACCAGCGAAAGCAGTCCCGTCAAGATGAAA
TTGAGGGTAACGTACGTGGAGCCTGGCCTGTGTCGTCGCAAGTATGCTAG
CATAGTGGTCCTGGGTGACTCCCACTTGTGCGCCGAAGGTAGAAGTCGGG
GTGATAGCTGCGATGGGGACTCCGGCGGACCACTGATGGCATTCCACGAG
GGCGTTTGGGTCCTTGGGGGCATTGTGTCCTTTGGCCTGAACTGCGGCTC
ACGATTCTGGCCAGCTGTCTACACAAATGTTCTTTCTTACGAAACGTGGA
TCACGCAGAATATACGACCTTAAGTTTATGCTCTCTCCATACACAAGCAT
AAATAGATTTTAATAAGGAAAGGTAGATGTGAACTCACCTTATCAATAAA
TGTGTTTCTGAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP10721.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG11313-RB 1439 CG11313-RB 192..1405 1..1214 6025 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26552348..26553017 1213..544 3320 99.7 Minus
chr3R 27901430 chr3R 26553080..26553542 543..81 2255 99.1 Minus
chr3R 27901430 chr3R 26553597..26553676 80..1 400 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:03:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30729836..30730506 1214..544 3325 99.7 Minus
3R 32079331 3R 30730569..30731031 543..81 2300 99.8 Minus
3R 32079331 3R 30731086..30731165 80..1 400 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:16:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30470667..30471337 1214..544 3325 99.7 Minus
3R 31820162 3R 30471400..30471862 543..81 2300 99.7 Minus
3R 31820162 3R 30471917..30471996 80..1 400 100 Minus
Blast to na_te.dros performed 2019-03-15 12:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker2 7672 Stalker2 STALKER2 7672bp 1397..1473 1123..1199 124 62.3 Plus

IP10721.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:30:58 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26552348..26553017 544..1213 99 <- Minus
chr3R 26553080..26553542 81..543 99 <- Minus
chr3R 26553597..26553676 1..80 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:46:54 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
CG11313-RA 1..1113 20..1123 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:43:58 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
CG11313-RB 1..1104 20..1123 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:43:32 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
CG11313-RC 1..1104 20..1123 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:25:39 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
CG11313-RA 1..1113 20..1123 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:00:33 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
CG11313-RC 1..1104 20..1123 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:17:26 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
CG11313-RA 1..1113 20..1123 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:43:58 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
CG11313-RB 192..1404 1..1213 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:43:32 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
CG11313-RC 1..1213 1..1213 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:25:39 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
CG11313-RA 1..1113 20..1123 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:00:33 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
CG11313-RC 1..1213 1..1213 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:30:58 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30729837..30730506 544..1213 99 <- Minus
3R 30730569..30731031 81..543 99 <- Minus
3R 30731086..30731165 1..80 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:30:58 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30729837..30730506 544..1213 99 <- Minus
3R 30730569..30731031 81..543 99 <- Minus
3R 30731086..30731165 1..80 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:30:58 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30729837..30730506 544..1213 99 <- Minus
3R 30730569..30731031 81..543 99 <- Minus
3R 30731086..30731165 1..80 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:43:32 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26555559..26556228 544..1213 99 <- Minus
arm_3R 26556291..26556753 81..543 99 <- Minus
arm_3R 26556808..26556887 1..80 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:05:16 Download gff for IP10721.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30470668..30471337 544..1213 99 <- Minus
3R 30471400..30471862 81..543 99 <- Minus
3R 30471917..30471996 1..80 100   Minus

IP10721.hyp Sequence

Translation from 0 to 1122

> IP10721.hyp
NSVASAMKVIAAVLLCLLIIRTAHGQYVSCRNPNQRTGYCVNIPLCVPLN
SVLAKSNPTDSEMRFIRESRCLVSDQSDLPFVCCTPDTDYNTTRARPNDE
VIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLR
TYCAGSLINNRYVVTAAHCVSAATRARKGDVVSVRLGEHNTSAVVDCLNG
RCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCLP
STVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKLRVTYVEPGLCRRKYAS
IVVLGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGS
RFWPAVYTNVLSYETWITQNIRP*

IP10721.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG11313-PC 367 CG11313-PC 1..367 7..373 1960 100 Plus
CG11313-PD 370 CG11313-PD 1..370 7..373 1946 99.2 Plus
CG9733-PB 417 CG9733-PB 1..416 7..372 883 46.3 Plus
CG9733-PA 418 CG9733-PA 1..417 7..372 866 46.2 Plus
Sp7-PF 391 CG3066-PF 12..391 10..373 652 39.2 Plus

IP10721.pep Sequence

Translation from 1 to 1122

> IP10721.pep
NSVASAMKVIAAVLLCLLIIRTAHGQYVSCRNPNQRTGYCVNIPLCVPLN
SVLAKSNPTDSEMRFIRESRCLVSDQSDLPFVCCTPDTDYNTTRARPNDE
VIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLR
TYCAGSLINNRYVVTAAHCVSAATRARKGDVVSVRLGEHNTSAVVDCLNG
RCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCLP
STVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKLRVTYVEPGLCRRKYAS
IVVLGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGS
RFWPAVYTNVLSYETWITQNIRP*

IP10721.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16188-PA 418 GF16188-PA 1..417 7..372 845 44.7 Plus
Dana\GF17682-PA 394 GF17682-PA 14..394 10..373 657 41.2 Plus
Dana\GF16252-PA 399 GF16252-PA 25..398 23..372 507 35.7 Plus
Dana\GF23198-PA 392 GF23198-PA 34..391 27..372 482 35 Plus
Dana\GF18202-PA 393 GF18202-PA 29..393 30..373 471 37.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11948-PA 417 GG11948-PA 1..416 7..372 884 47 Plus
Dere\GG11914-PA 357 GG11914-PA 1..357 7..373 876 51.8 Plus
Dere\GG11768-PA 356 GG11768-PA 1..356 7..373 855 50.9 Plus
Dere\GG11909-PA 351 GG11909-PA 1..351 7..373 819 50.1 Plus
Dere\GG14174-PA 391 GG14174-PA 1..391 3..373 616 38.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18317-PA 379 GH18317-PA 2..379 28..373 666 39.9 Plus
Dgri\GH18417-PA 435 GH18417-PA 167..434 104..372 622 46.7 Plus
Dgri\GH14281-PA 578 GH14281-PA 220..578 27..373 491 34.9 Plus
Dgri\GH18418-PA 441 GH18418-PA 43..433 29..372 449 33 Plus
Dgri\GH19111-PA 344 GH19111-PA 65..344 103..373 443 42.5 Plus
Dgri\GH18417-PA 435 GH18417-PA 1..88 7..95 190 43.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG11313-PC 367 CG11313-PC 1..367 7..373 1960 100 Plus
CG11313-PD 370 CG11313-PD 1..370 7..373 1946 99.2 Plus
CG9733-PB 417 CG9733-PB 1..416 7..372 883 46.3 Plus
CG9733-PA 418 CG9733-PA 1..417 7..372 866 46.2 Plus
Sp7-PF 391 CG3066-PF 12..391 10..373 652 39.2 Plus
Sp7-PE 391 CG3066-PE 12..391 10..373 652 39.2 Plus
Sp7-PA 391 CG3066-PA 12..391 10..373 652 39.2 Plus
SPE-PA 400 CG16705-PA 44..400 38..373 507 35.8 Plus
MP1-PA 390 CG1102-PA 29..389 30..372 493 36.8 Plus
MP1-PC 399 CG1102-PC 29..398 30..372 493 36.6 Plus
ea-PA 392 CG4920-PA 34..390 27..371 489 35.4 Plus
MP1-PE 400 CG1102-PE 29..399 30..372 483 36 Plus
CG9737-PA 424 CG9737-PA 28..406 30..367 432 32.6 Plus
grass-PB 377 CG5896-PB 3..372 3..371 411 30.1 Plus
ea-PB 261 CG4920-PB 2..259 127..371 408 38.6 Plus
CG3505-PA 360 CG3505-PA 37..359 37..372 393 34.7 Plus
grass-PA 335 CG5896-PA 60..330 105..371 391 35.5 Plus
CG31220-PB 363 CG31220-PB 89..363 107..373 385 36.3 Plus
CG10232-PD 509 CG10232-PD 181..509 33..373 381 32.6 Plus
Ser7-PA 397 CG2045-PA 51..393 60..372 380 31.9 Plus
CG16710-PB 372 CG16710-PB 13..366 13..371 378 32.3 Plus
CG5909-PA 381 CG5909-PA 2..381 3..372 376 30.2 Plus
CG31219-PB 345 CG31219-PB 74..345 107..373 358 33.5 Plus
CG12133-PB 340 CG12133-PB 47..321 107..371 357 36 Plus
CG1299-PB 442 CG1299-PB 95..439 30..372 357 30.9 Plus
CG1299-PA 511 CG1299-PA 164..508 30..372 357 30.9 Plus
CG8172-PD 371 CG8172-PD 124..364 120..369 346 36.2 Plus
CG8172-PE 545 CG8172-PE 298..538 120..369 346 36.2 Plus
CG8172-PF 561 CG8172-PF 314..554 120..369 346 36.2 Plus
CG17572-PA 385 CG17572-PA 54..384 23..373 343 29.7 Plus
CG11836-PI 281 CG11836-PI 36..274 113..371 339 33 Plus
CG11836-PJ 333 CG11836-PJ 88..326 113..371 339 33 Plus
CG7432-PB 721 CG7432-PB 435..720 86..372 338 33.1 Plus
CG8870-PA 356 CG8870-PA 5..342 9..372 328 32.5 Plus
CG30287-PA 284 CG30287-PA 41..277 121..367 327 35.8 Plus
CG18735-PA 364 CG18735-PA 74..316 113..372 325 34.1 Plus
l(2)k05911-PC 639 CG31728-PC 410..639 132..372 325 34.4 Plus
CG30289-PA 316 CG30289-PA 18..271 98..367 318 34.4 Plus
CG11836-PF 223 CG11836-PF 11..216 152..371 316 34.2 Plus
CG11836-PE 223 CG11836-PE 11..216 152..371 316 34.2 Plus
CG11836-PG 223 CG11836-PG 11..216 152..371 316 34.2 Plus
CG11836-PC 223 CG11836-PC 11..216 152..371 316 34.2 Plus
CG11836-PA 223 CG11836-PA 11..216 152..371 316 34.2 Plus
CG11836-PB 223 CG11836-PB 11..216 152..371 316 34.2 Plus
CG4386-PA 372 CG4386-PA 86..354 85..367 303 31.1 Plus
CG32260-PC 395 CG32260-PC 146..392 120..371 302 35.1 Plus
CG32260-PA 575 CG32260-PA 326..572 120..371 302 35.1 Plus
CG30088-PB 281 CG30088-PB 22..272 99..367 301 32.4 Plus
CG11843-PB 316 CG11843-PB 68..313 122..371 301 31.5 Plus
CG11843-PA 316 CG11843-PA 68..313 122..371 301 31.5 Plus
CG30286-PB 277 CG30286-PB 43..268 130..367 298 33.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24319-PA 436 GI24319-PA 159..435 101..372 677 48.4 Plus
Dmoj\GI24127-PA 389 GI24127-PA 7..388 14..372 650 38.2 Plus
Dmoj\GI24877-PA 392 GI24877-PA 2..392 7..373 496 34.3 Plus
Dmoj\GI22780-PA 412 GI22780-PA 24..412 22..373 470 34.8 Plus
Dmoj\GI10853-PA 285 GI10853-PA 6..284 104..372 436 40.8 Plus
Dmoj\GI24319-PA 436 GI24319-PA 1..89 10..98 182 47.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14056-PA 423 GL14056-PA 1..422 7..372 884 45.2 Plus
Dper\GL12453-PA 383 GL12453-PA 1..383 3..373 651 39.8 Plus
Dper\GL23240-PA 395 GL23240-PA 35..395 26..373 488 35.9 Plus
Dper\GL13652-PA 401 GL13652-PA 46..400 38..372 473 35.4 Plus
Dper\GL12316-PA 391 GL12316-PA 29..391 30..373 454 36.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21994-PA 423 GA21994-PA 1..422 7..372 886 45.2 Plus
Dpse\GA15903-PA 383 GA15903-PA 1..383 3..373 653 39.8 Plus
Dpse\GA27509-PA 383 GA27509-PA 1..383 3..373 647 39.6 Plus
Dpse\GA15903-PB 241 GA15903-PB 1..241 136..373 498 44.4 Plus
Dpse\GA27509-PB 241 GA27509-PB 1..241 136..373 494 44 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12163-PA 418 GM12163-PA 1..417 7..372 860 46.4 Plus
Dsec\GM10972-PA 391 GM10972-PA 12..391 10..373 621 37.8 Plus
Dsec\GM12134-PA 149 GM12134-PA 4..149 228..373 581 76.7 Plus
Dsec\GM26516-PA 400 GM26516-PA 21..400 18..373 498 34.8 Plus
Dsec\GM26518-PA 406 GM26518-PA 8..405 14..372 491 34.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16858-PA 352 GD16858-PA 1..352 7..373 1300 70.6 Plus
Dsim\GD17168-PA 418 GD17168-PA 1..417 7..372 860 46.2 Plus
Dsim\GD19946-PA 391 GD19946-PA 12..391 10..373 631 38 Plus
Dsim\GD21025-PA 400 GD21025-PA 44..400 38..373 499 35.2 Plus
Dsim\GD21026-PA 406 GD21026-PA 8..405 14..372 490 33.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10404-PA 426 GJ10404-PA 15..425 26..372 763 41.5 Plus
Dvir\GJ10951-PA 386 GJ10951-PA 3..385 5..372 681 40.8 Plus
Dvir\GJ24520-PA 877 GJ24520-PA 518..876 26..372 480 35.2 Plus
Dvir\GJ22783-PA 401 GJ22783-PA 21..400 22..372 459 35.2 Plus
Dvir\GJ10405-PA 415 GJ10405-PA 33..415 29..373 458 33.4 Plus
Dvir\GJ24520-PA 877 GJ24520-PA 215..504 104..371 281 31 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13136-PA 412 GK13136-PA 1..411 7..372 830 43.8 Plus
Dwil\GK12018-PA 384 GK12018-PA 28..384 29..373 626 39.6 Plus
Dwil\GK22647-PA 279 GK22647-PA 1..279 94..373 502 40.5 Plus
Dwil\GK11130-PA 392 GK11130-PA 3..391 8..372 464 33.8 Plus
Dwil\GK13188-PA 395 GK13188-PA 40..394 38..372 455 35.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23362-PA 364 GE23362-PA 1..364 7..373 1245 65 Plus
Dyak\GE23396-PA 417 GE23396-PA 1..416 7..372 880 47.2 Plus
Dyak\GE24940-PA 391 GE24940-PA 1..391 3..373 615 37.5 Plus
Dyak\GE10383-PA 404 GE10383-PA 14..403 9..372 509 35 Plus
Dyak\GE10382-PA 400 GE10382-PA 28..400 23..373 503 34.9 Plus