Clone IP10749 Report

Search the DGRC for IP10749

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:107
Well:49
Vector:pOT2
Associated Gene/Transcriptcuff-RA
Protein status:IP10749.pep: gold
Preliminary Size:1155
Sequenced Size:1315

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13190 2005-01-01 Successful iPCR screen
CG13190 2008-04-29 Release 5.5 accounting
CG13190 2008-08-15 Release 5.9 accounting
CG13190 2008-12-18 5.12 accounting

Clone Sequence Records

IP10749.complete Sequence

1315 bp (1315 high quality bases) assembled on 2006-01-26

GenBank Submission: BT024325

> IP10749.complete
CTGGCTTCCGTCTTCACCACAAAATCTTACCAAAGTCGTTTTTAAGATGA
ATTCTAATTACACAATATTAAACATCCGGGCTCACTCCTGGGCCGAGAAG
GACAATTTGGTATTTCCAACTATTACCAAGCCCGTTTCGAATGGCTGGTT
CGCCTGGTCGCCAATCGGGCAATTCGAACCAAATTCTCAAAAAGTGCCCT
ACGTCGTGGTGCCGCCAAGCATCAAATTTCCCATTTCTCTTCGGTACAAA
GATTCACCGCCGAAGCTGGAAAAGAAGCCCAACATTTTTCTGGACAACAT
GCTCCAGTATATAGAATCTTCGTCGTACATGTACGTTATGGTAAGAAACA
ACCAGCAGGCACAGCTAAATGCCAATATAGTGTGCACCAGCGAAGTCCTG
GAGCTGATGATGTGTGCTCCCTACGAAAAGAAGACTGGATGGTCATTGGG
TGTCACCCGGTATCGCAACACAATGTACATTTGCCGCATTGATGTTGAAC
AACCCGACCCCATTGATCAGGACAATCTGAAGAGGGCCATGCAAGAATTT
TGGCTTAGGAATCTTCGAACCCATTGTGTTTTTGAAAACGGCATTAAGAT
GCACCAGCACAATCAATCTTCTGAAGAACATTTACGCTTTCATGGTGTAT
TTTCCTTTGATTTGAATGGTAATCGAGTTCTATTTGATTCTCCAGTACTA
GCCGAGATGCCAAGCACAACATTGAATGGGTCTGCTCTAAGCTGGGTAGA
CCTGCAGATACGCCCTATGTTCATGAGTCGACTGGATTGGCCAGAGCACA
ATCGCACAGAGGCCCTTAAGTGGTGGGTCAAGTGTTTTCTGTTGGGAATC
GAAAGCCTCTATATAGCCCGCCGCGATGAAAACGCCCATGTGCACAACAT
TGAAAAGACTTTGGTGCGGGATTTATGGAAGTCTTGCGAAAAAGATTGGT
CGCCCACAGTGTGCGCCAACTTCATGATTTACCTACTCAATTGTATTTCC
CAAGTTATGGCGCCGATCGACTGCCCCAGCACCGTTTACCTTTTTCAGTT
CGACGCGAGCCAAGGAACAGTATCATACAAGGGCTTGCGAGGGCGCAATC
AGTACACGTTCGTTTCGGACTGGTTCCGGATGATGCTGGACGATCACACG
AACGATATGTGTAAGACACCGAATTTGCAAACCATGTCTTCTATAGTTTA
ACAATAACAATGAGAACTGGCAAAGAAATATGAATACCGAAATAGCAGAA
CAAAAGTGGTTAACTAATTAAATGAAGATTTAAGTTTATTGCGACATAAA
AAAAAAAAAAAAAAA

IP10749.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
cuff-RA 1334 cuff-RA 3..1297 5..1299 6475 100 Plus
ERp60-RA 2023 ERp60-RA 1932..2023 1299..1208 460 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7773340..7773919 5..584 2900 100 Plus
chr2R 21145070 chr2R 7774515..7774874 938..1297 1800 100 Plus
chr2R 21145070 chr2R 7774191..7774405 724..938 1075 100 Plus
chr2R 21145070 chr2R 7773977..7774122 579..724 715 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:03:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11886069..11886648 5..584 2900 100 Plus
2R 25286936 2R 11887244..11887605 938..1299 1810 100 Plus
2R 25286936 2R 11886920..11887134 724..938 1075 100 Plus
2R 25286936 2R 11886706..11886851 579..724 715 99.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11887268..11887847 5..584 2900 100 Plus
2R 25260384 2R 11888443..11888804 938..1299 1810 100 Plus
2R 25260384 2R 11888119..11888333 724..938 1075 100 Plus
2R 25260384 2R 11887905..11888050 579..724 715 99.3 Plus
Blast to na_te.dros performed on 2019-03-15 12:33:29 has no hits.

IP10749.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:34:36 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7774191..7774404 724..937 100 -> Plus
chr2R 7773336..7773919 1..584 99 -> Plus
chr2R 7773983..7774121 585..723 100 -> Plus
chr2R 7774515..7774874 938..1297 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:47:04 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
CG13190-RA 1..1155 47..1201 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:33:12 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
cuff-RA 1..1155 47..1201 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:45:18 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
cuff-RA 1..1155 47..1201 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:07:17 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
CG13190-RA 1..1155 47..1201 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:03:22 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
cuff-RA 1..1155 47..1201 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:04:37 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
CG13190-RA 1..1295 4..1297 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:33:12 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
cuff-RA 1..1295 4..1297 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:45:18 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
cuff-RA 1..1295 4..1297 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:07:17 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
CG13190-RA 1..1295 4..1297 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:03:22 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
cuff-RA 1..1295 4..1297 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:34:36 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11886065..11886648 1..584 99 -> Plus
2R 11886712..11886850 585..723 100 -> Plus
2R 11886920..11887133 724..937 100 -> Plus
2R 11887244..11887603 938..1297 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:34:36 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11886065..11886648 1..584 99 -> Plus
2R 11886712..11886850 585..723 100 -> Plus
2R 11886920..11887133 724..937 100 -> Plus
2R 11887244..11887603 938..1297 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:34:36 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11886065..11886648 1..584 99 -> Plus
2R 11886712..11886850 585..723 100 -> Plus
2R 11886920..11887133 724..937 100 -> Plus
2R 11887244..11887603 938..1297 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:45:18 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7773570..7774153 1..584 99 -> Plus
arm_2R 7774217..7774355 585..723 100 -> Plus
arm_2R 7774425..7774638 724..937 100 -> Plus
arm_2R 7774749..7775108 938..1297 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:57:44 Download gff for IP10749.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11887911..11888049 585..723 100 -> Plus
2R 11887264..11887847 1..584 99 -> Plus
2R 11888119..11888332 724..937 100 -> Plus
2R 11888443..11888802 938..1297 100   Plus

IP10749.hyp Sequence

Translation from 0 to 1200

> IP10749.hyp
SLPSSPQNLTKVVFKMNSNYTILNIRAHSWAEKDNLVFPTITKPVSNGWF
AWSPIGQFEPNSQKVPYVVVPPSIKFPISLRYKDSPPKLEKKPNIFLDNM
LQYIESSSYMYVMVRNNQQAQLNANIVCTSEVLELMMCAPYEKKTGWSLG
VTRYRNTMYICRIDVEQPDPIDQDNLKRAMQEFWLRNLRTHCVFENGIKM
HQHNQSSEEHLRFHGVFSFDLNGNRVLFDSPVLAEMPSTTLNGSALSWVD
LQIRPMFMSRLDWPEHNRTEALKWWVKCFLLGIESLYIARRDENAHVHNI
EKTLVRDLWKSCEKDWSPTVCANFMIYLLNCISQVMAPIDCPSTVYLFQF
DASQGTVSYKGLRGRNQYTFVSDWFRMMLDDHTNDMCKTPNLQTMSSIV*

IP10749.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:31:44
Subject Length Description Subject Range Query Range Score Percent Strand
cuff-PA 384 CG13190-PA 1..384 16..399 2086 100 Plus
CG9125-PA 375 CG9125-PA 15..371 28..379 161 21.6 Plus

IP10749.pep Sequence

Translation from 46 to 1200

> IP10749.pep
MNSNYTILNIRAHSWAEKDNLVFPTITKPVSNGWFAWSPIGQFEPNSQKV
PYVVVPPSIKFPISLRYKDSPPKLEKKPNIFLDNMLQYIESSSYMYVMVR
NNQQAQLNANIVCTSEVLELMMCAPYEKKTGWSLGVTRYRNTMYICRIDV
EQPDPIDQDNLKRAMQEFWLRNLRTHCVFENGIKMHQHNQSSEEHLRFHG
VFSFDLNGNRVLFDSPVLAEMPSTTLNGSALSWVDLQIRPMFMSRLDWPE
HNRTEALKWWVKCFLLGIESLYIARRDENAHVHNIEKTLVRDLWKSCEKD
WSPTVCANFMIYLLNCISQVMAPIDCPSTVYLFQFDASQGTVSYKGLRGR
NQYTFVSDWFRMMLDDHTNDMCKTPNLQTMSSIV*

IP10749.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:10:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13104-PA 387 GF13104-PA 10..378 1..370 910 45.3 Plus
Dana\GF21826-PA 374 GF21826-PA 29..372 23..364 256 25 Plus
Dana\GF22289-PA 397 GF22289-PA 12..377 10..365 226 23 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:10:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20228-PA 376 GG20228-PA 1..369 1..371 1501 76 Plus
Dere\GG18221-PA 376 GG18221-PA 1..376 1..368 210 22.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21477-PA 274 GH21477-PA 2..261 110..366 555 38.5 Plus
Dgri\GH12029-PA 370 GH12029-PA 1..366 1..364 268 22.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
cuff-PA 384 CG13190-PA 1..384 1..384 2086 100 Plus
CG9125-PA 375 CG9125-PA 15..371 13..364 161 21.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:10:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19954-PA 383 GI19954-PA 1..370 1..366 692 36.8 Plus
Dmoj\GI20862-PA 370 GI20862-PA 37..358 33..365 309 26.4 Plus
Dmoj\GI14302-PA 387 GI14302-PA 14..376 8..364 271 22.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:10:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25389-PA 318 GL25389-PA 14..313 70..374 667 44.9 Plus
Dper\GL10090-PA 318 GL10090-PA 3..313 60..374 664 44.3 Plus
Dper\GL18293-PA 379 GL18293-PA 17..375 11..364 285 25.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22760-PA 371 GA22760-PA 1..370 1..374 780 44 Plus
Dpse\GA25073-PA 316 GA25073-PA 3..310 60..371 645 43.8 Plus
Dpse\GA27396-PA 379 GA27396-PA 17..375 11..364 279 24.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21314-PA 386 GM21314-PA 1..382 1..384 1745 84.6 Plus
Dsec\GM13363-PA 375 GM13363-PA 4..371 2..364 193 21.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10820-PA 366 GD10820-PA 1..362 21..384 1666 85.2 Plus
Dsim\GD15720-PA 375 GD15720-PA 4..375 2..368 222 22.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17876-PA 385 GJ17876-PA 1..377 1..371 735 38.1 Plus
Dvir\GJ20597-PA 267 GJ20597-PA 9..266 107..366 270 30.4 Plus
Dvir\GJ19359-PA 382 GJ19359-PA 14..376 8..364 258 22.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22047-PA 368 GK22047-PA 21..358 2..370 613 34.3 Plus
Dwil\GK25715-PA 391 GK25715-PA 21..383 13..366 241 23.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12388-PA 377 GE12388-PA 1..370 1..371 1472 72.8 Plus
Dyak\GE15640-PA 376 GE15640-PA 1..376 1..368 174 20 Plus