Clone IP10836 Report

Search the DGRC for IP10836

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:108
Well:36
Vector:pOT2
Associated Gene/TranscriptCG18063-RC
Protein status:IP10836.pep: gold
Preliminary Size:1089
Sequenced Size:1319

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18063 2005-01-01 Successful iPCR screen
CG18063 2008-04-29 Release 5.5 accounting
CG18063 2008-08-15 Release 5.9 accounting
CG18063 2008-12-18 5.12 accounting

Clone Sequence Records

IP10836.complete Sequence

1319 bp (1319 high quality bases) assembled on 2005-05-04

GenBank Submission: BT023147

> IP10836.complete
TTCTTTATGCCTTAGATTTTGATTTCATACACATAATAGTATAACCACTG
TCTCTGGAAGATCTTCTTATATTTTGTATTAAAATGCCAAAGCCCTCTAA
ACAGGACTCTATCTCGTTAAAATCCAGTAACTCAGTTTTTTTGGAAGATG
ACCAATTCGAAAATCTAGAGGAAGAGTTTCTGCATAATGAATGCATTAGT
TTACCCTCCGACTTAACGAGAGTACAAAGTGTTATTTTGGACTACAAGCA
GTTCAAAGCGGCTCGCACAATTCAGCGTTATATTCACGGATGGCTAGTTC
GAGAAAATTTCCGAAAACTTCAGAAGTCTGCGATTATTATTCAAAAATGG
TGGCGCCGTTTTGAGGCTCAGAAAAATTTGCTTTATGTGGCCGAAAGCGC
TTTGCAGTCGGCTGTTTTGGCCCATTACGACAAGTCTGCTACCCTGATTC
AGACGCTCTATCGCGGATGGTGGTCGCGAAAACATATCTTTGACCTAACC
ATGCTCAAGAGCGTGCAGATAATGTTGGCAAAGGACCTGATTCACTCTTT
GGTCAATTACTTGCACGCAACGAAAAATTCTGAAATGCTTCCAGGCATTT
ACACGATACGGGACTCGAGCATATGTCTGGAAACATTGGAGGAACTGATG
GCAACATTTGGCTTTCGATTCTATAACGCTAATGCTTGCTACAAAATGAA
GGAAACGTTGTCAATGGTGGCACAGAGCCGAAAGACGTTTACGGCCACAT
CCTATTTCACGGATGTACCATATCCCGGGTTTAATGATCGAGGATTTTGT
GGCCCTCGGCAGAATTCTGCCATGACCTTGAATGCCAAAGATCCAGAACA
TTATGAATTGATTCACATATTCCTGTCCGGTAGTAGAAAAATTGGCATGA
CAACGGCTAAGCTCGAACAGAAAATAGCCAACATTGCAGAAGAAAATCGC
TTAAATATGTTTATAAAGAGGGACAACAAGAAAAAGAGTTTTATTAAAAG
GATTTATCTTGACATGAAGAACTGGCATTACTCAAATGGAGATCCAATTC
TTCCCATCAGCTTGTTTAAAAATAGTGAGATGCCTGCGGTCCTGGAAAGT
GCCAAGAAAACTCTGGAATCAATTTTTGGTGAACTGGAGCCGTGTGTTTG
TCCAACGAACAAAGAAATATCTTTCCTTTTAAATTCTCTTAATGATTCTT
AAGGAGTTAATAATCTTTGTATATTATATATCGTTGTAAACCTTACGAAT
ATTTCACAATAAAGAACCTTTAAGATAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

IP10836.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG18063-RC 1312 CG18063-RC 30..1306 1..1277 6385 100 Plus
CG18063-RE 1312 CG18063-RE 30..1306 1..1277 6385 100 Plus
CG18063-RD 1309 CG18063-RD 30..1303 1..1277 6315 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15956982..15957382 219..619 1990 99.8 Plus
chr2L 23010047 chr2L 15957495..15957826 618..949 1660 100 Plus
chr2L 23010047 chr2L 15957894..15958221 949..1276 1640 100 Plus
chr2L 23010047 chr2L 15956656..15956773 1..118 590 100 Plus
chr2L 23010047 chr2L 15956829..15956930 119..220 510 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:03:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15958184..15958584 219..619 2005 100 Plus
2L 23513712 2L 15958697..15959028 618..949 1660 100 Plus
2L 23513712 2L 15959097..15959425 949..1277 1645 100 Plus
2L 23513712 2L 15957858..15957975 1..118 590 100 Plus
2L 23513712 2L 15958031..15958132 119..220 510 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:16:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15958184..15958584 219..619 2005 100 Plus
2L 23513712 2L 15958697..15959028 618..949 1660 100 Plus
2L 23513712 2L 15959097..15959425 949..1277 1645 100 Plus
2L 23513712 2L 15957858..15957975 1..118 590 100 Plus
2L 23513712 2L 15958031..15958132 119..220 510 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:59:33 has no hits.

IP10836.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:00:35 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15956656..15956773 1..118 100 -> Plus
chr2L 15956829..15956930 119..220 100 -> Plus
chr2L 15956984..15957382 221..619 99 -> Plus
chr2L 15957497..15957825 620..948 100 -> Plus
chr2L 15957894..15958221 949..1276 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:47:22 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
CG18063-RC 1..1119 84..1202 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:44:07 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
CG18063-RE 1..1119 84..1202 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:05:58 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
CG18063-RC 1..1119 84..1202 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:25:20 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
CG18063-RA 1..865 84..948 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:25:32 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
CG18063-RC 1..1119 84..1202 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:17:03 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
CG18063-RC 1..1276 1..1276 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:44:07 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
CG18063-RC 1..1276 1..1276 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:05:58 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
CG18063-RC 1..1276 1..1276 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:25:21 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
CG18063-RA 1..940 9..948 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:25:32 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
CG18063-RC 1..1276 1..1276 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:00:35 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15959097..15959424 949..1276 100   Plus
2L 15957858..15957975 1..118 100 -> Plus
2L 15958031..15958132 119..220 100 -> Plus
2L 15958186..15958584 221..619 100 -> Plus
2L 15958699..15959027 620..948 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:00:35 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15959097..15959424 949..1276 100   Plus
2L 15957858..15957975 1..118 100 -> Plus
2L 15958031..15958132 119..220 100 -> Plus
2L 15958186..15958584 221..619 100 -> Plus
2L 15958699..15959027 620..948 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:00:35 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15959097..15959424 949..1276 100   Plus
2L 15957858..15957975 1..118 100 -> Plus
2L 15958031..15958132 119..220 100 -> Plus
2L 15958186..15958584 221..619 100 -> Plus
2L 15958699..15959027 620..948 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:05:58 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15959097..15959424 949..1276 100   Plus
arm_2L 15957858..15957975 1..118 100 -> Plus
arm_2L 15958031..15958132 119..220 100 -> Plus
arm_2L 15958186..15958584 221..619 100 -> Plus
arm_2L 15958699..15959027 620..948 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:05:21 Download gff for IP10836.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15958186..15958584 221..619 100 -> Plus
2L 15958699..15959027 620..948 100 -> Plus
2L 15959097..15959424 949..1276 100   Plus
2L 15958031..15958132 119..220 100 -> Plus
2L 15957858..15957975 1..118 100 -> Plus

IP10836.pep Sequence

Translation from 83 to 1201

> IP10836.pep
MPKPSKQDSISLKSSNSVFLEDDQFENLEEEFLHNECISLPSDLTRVQSV
ILDYKQFKAARTIQRYIHGWLVRENFRKLQKSAIIIQKWWRRFEAQKNLL
YVAESALQSAVLAHYDKSATLIQTLYRGWWSRKHIFDLTMLKSVQIMLAK
DLIHSLVNYLHATKNSEMLPGIYTIRDSSICLETLEELMATFGFRFYNAN
ACYKMKETLSMVAQSRKTFTATSYFTDVPYPGFNDRGFCGPRQNSAMTLN
AKDPEHYELIHIFLSGSRKIGMTTAKLEQKIANIAEENRLNMFIKRDNKK
KSFIKRIYLDMKNWHYSNGDPILPISLFKNSEMPAVLESAKKTLESIFGE
LEPCVCPTNKEISFLLNSLNDS*

IP10836.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14929-PA 578 GF14929-PA 293..565 16..287 700 48.4 Plus
Dana\GF13314-PA 366 GF13314-PA 44..353 44..356 363 27.8 Plus
Dana\GF14929-PA 578 GF14929-PA 27..236 24..232 354 33.6 Plus
Dana\GF14926-PA 315 GF14926-PA 4..183 59..239 263 28.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25182-PA 307 GG25182-PA 1..291 1..289 1147 74.6 Plus
Dere\GG20062-PA 367 GG20062-PA 45..354 44..356 393 30 Plus
Dere\GG25178-PA 352 GG25178-PA 1..246 20..260 377 34.7 Plus
Dere\GG25181-PA 391 GG25181-PA 52..309 45..307 341 30.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23059-PA 329 GH23059-PA 6..323 23..356 423 32.4 Plus
Dgri\GH10387-PA 350 GH10387-PA 31..297 46..314 361 31 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG18063-PE 372 CG18063-PE 1..372 1..372 1934 100 Plus
CG18063-PC 372 CG18063-PC 1..372 1..372 1934 100 Plus
CG18063-PD 371 CG18063-PD 1..371 1..372 1918 99.7 Plus
CG13544-PA 367 CG13544-PA 45..354 44..356 398 30.6 Plus
CG12448-PC 352 CG12448-PC 52..309 45..307 374 31.2 Plus
CG31735-PC 312 CG31735-PC 2..193 57..249 326 34.7 Plus
CG31735-PA 312 CG31735-PA 2..193 57..249 326 34.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17366-PA 304 GI17366-PA 59..302 45..288 374 33.6 Plus
Dmoj\GI21130-PA 355 GI21130-PA 41..344 50..356 367 29.7 Plus
Dmoj\GI12944-PA 310 GI12944-PA 1..189 52..241 354 36.3 Plus
Dmoj\GI17367-PA 209 GI17367-PA 6..192 81..267 276 32.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11293-PA 587 GL11293-PA 243..585 20..363 429 30.5 Plus
Dper\GL15302-PA 357 GL15302-PA 39..236 33..232 400 38 Plus
Dper\GL15300-PA 351 GL15300-PA 19..311 40..332 378 30.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12353-PA 543 GA12353-PA 198..541 19..363 425 30.1 Plus
Dpse\GA11642-PA 357 GA11642-PA 30..236 26..232 400 37.3 Plus
Dpse\GA29041-PA 635 GA29041-PA 278..595 14..332 373 30.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18643-PA 208 GM18643-PA 1..208 1..209 961 91.4 Plus
Dsec\GM18642-PA 375 GM18642-PA 34..291 45..307 351 31.2 Plus
Dsec\GM15577-PA 359 GM15577-PA 45..346 44..356 330 29.3 Plus
Dsec\GM18639-PA 353 GM18639-PA 15..247 21..260 285 30.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24030-PA 371 GD24030-PA 1..371 1..372 1802 92 Plus
Dsim\GD25077-PA 367 GD25077-PA 45..354 44..356 399 30.6 Plus
Dsim\GD24026-PA 352 GD24026-PA 5..246 21..260 359 32.9 Plus
Dsim\GD24029-PA 393 GD24029-PA 52..309 45..307 359 31.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18189-PA 334 GJ18189-PA 19..315 50..345 366 29.7 Plus
Dvir\GJ20979-PA 263 GJ20979-PA 5..252 104..356 299 28.3 Plus
Dvir\GJ18044-PA 246 GJ18044-PA 5..123 80..203 173 28 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19591-PA 368 GK19591-PA 41..368 39..365 417 30.9 Plus
Dwil\GK24765-PA 346 GK24765-PA 30..333 50..356 394 32.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21233-PA 391 GE21233-PA 1..391 1..372 1573 74.2 Plus
Dyak\GE11599-PA 362 GE11599-PA 40..349 44..356 413 31.6 Plus
Dyak\GE21188-PA 350 GE21188-PA 24..246 39..260 352 33.9 Plus
Dyak\GE21222-PA 392 GE21222-PA 52..309 45..307 347 32 Plus

IP10836.hyp Sequence

Translation from 83 to 1201

> IP10836.hyp
MPKPSKQDSISLKSSNSVFLEDDQFENLEEEFLHNECISLPSDLTRVQSV
ILDYKQFKAARTIQRYIHGWLVRENFRKLQKSAIIIQKWWRRFEAQKNLL
YVAESALQSAVLAHYDKSATLIQTLYRGWWSRKHIFDLTMLKSVQIMLAK
DLIHSLVNYLHATKNSEMLPGIYTIRDSSICLETLEELMATFGFRFYNAN
ACYKMKETLSMVAQSRKTFTATSYFTDVPYPGFNDRGFCGPRQNSAMTLN
AKDPEHYELIHIFLSGSRKIGMTTAKLEQKIANIAEENRLNMFIKRDNKK
KSFIKRIYLDMKNWHYSNGDPILPISLFKNSEMPAVLESAKKTLESIFGE
LEPCVCPTNKEISFLLNSLNDS*

IP10836.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:32:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG18063-PE 372 CG18063-PE 1..372 1..372 1934 100 Plus
CG18063-PC 372 CG18063-PC 1..372 1..372 1934 100 Plus
CG18063-PD 371 CG18063-PD 1..371 1..372 1918 99.7 Plus
CG13544-PA 367 CG13544-PA 45..354 44..356 398 30.6 Plus
CG12448-PC 352 CG12448-PC 52..309 45..307 374 31.2 Plus