Clone IP10855 Report

Search the DGRC for IP10855

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:108
Well:55
Vector:pOT2
Associated Gene/TranscriptCG30053-RA
Protein status:IP10855.pep: gold
Preliminary Size:1008
Sequenced Size:1167

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30053 2005-01-01 Successful iPCR screen
CG30053 2008-04-29 Release 5.5 accounting
CG30053 2008-08-15 Release 5.9 accounting
CG30053 2008-12-18 5.12 accounting

Clone Sequence Records

IP10855.complete Sequence

1167 bp (1167 high quality bases) assembled on 2006-09-21

GenBank Submission: BT029084

> IP10855.complete
CTCAAAGGTGTAAGGAACATGGCGGAGGAGCTAAAAGTGTTCTTCGAAGA
GTGTCGTGGACAAGGGTTTTCCGCAAAGGAAATGCTGGCTGTATGTCAAC
CTTTGATTTGGAGAATCCGCTTGGCTCGAATCAAGAAATGGTTCTTCATC
CTACTGCCCCTGATGGTTATTTATCTGCTTTGGCTATGCAGTGACACCTT
TTCTTGGTGGCTAAGTGCCCTGGGTCGATTGGTGCTCATACAGATCCTTC
CACTCTGGGATTGGCGGCCCTACTATCATGCCAAGTGCCTGATACCACGC
GATCAAAGTGTCCAAGAGCAGGCACCATCATTGGGTAAAGCGGAGACCTT
GCGGCAGAATTGCGATCTCTGTGAAGGTTTGGAGGGAATAGGCACGGTTT
CCAATGTAAGCTACTCCTCCTTGGAGTCTGAGCACCTAGAACGTGGGCAA
CCAGTGATTATAACAGACACTGGACTGCAAACGGATGTTTTTAGTCTCCT
AGAGCAAATAGAGAAGAAGTCACCTCAGTGGCTAACCAGTGAACCTTGTG
ATGTTTCCAGCAATCTGTTGCTGAGGAAACTTTTTAACCTAGAGGCGGCT
CTGGATAAGATTCATTCCTGGCAGGGACAGACATCGAATTCTTGGCACCT
TCAACTGAGGAACTGCCAGAAGAAGGCGGTGAAGTCCTCTCGGCTTTTTC
TGGATCGTCCCTACTACTACCCACTTCACCTGGCCCCGTATTACTCCAGC
TGGCTATTGGCAGTCCATCAGCAAAAGCGAAACCAAGCCGATATATACGT
GCGTGGCCTAGTGCTCATCCAGCAACTGAGTGGCCACTTTGAGATGGTTC
TCCATCCAAAGAAGCCCTGCAATAAAGGAATATGTCCAAGCTTGCGGATG
CGACTGAATGCAGGAGAAGGTCTGATCTTTACCACGGATATCTGGAGCCT
AAGTTATGGTCTGGAGAAACCCCACGGAAAGCTGACCTCCCTGGCTAGCA
TTTTCGAGATAGACTGGCAGCCGTAGAGTGTTTTAGTTAGCCGAAATTGT
ATTTACACACCCAACTAGATACAGACGAATCGAAGCCTAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAA

IP10855.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:15:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG30053-RA 1183 CG30053-RA 60..1150 1..1091 5440 99.9 Plus
CG13148.a 1494 CG13148.a 1438..1494 1091..1035 285 100 Minus
CG13148-RB 1607 CG13148-RB 1551..1607 1091..1035 285 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8575996..8576702 1088..382 3490 99.6 Minus
chr2R 21145070 chr2R 8576758..8577139 382..1 1895 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:03:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12688730..12689439 1091..382 3550 100 Minus
2R 25286936 2R 12689495..12689876 382..1 1895 99.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12689929..12690638 1091..382 3550 100 Minus
2R 25260384 2R 12690694..12691075 382..1 1895 99.7 Minus
Blast to na_te.dros performed on 2019-03-15 12:50:24 has no hits.

IP10855.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:51:15 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8575996..8576701 383..1088 99 <- Minus
chr2R 8576758..8577139 1..382 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:47:31 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
CG30053-RA 1..1008 19..1026 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:26:04 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
CG30053-RA 1..1008 19..1026 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:50:58 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
CG30053-RA 1..1008 19..1026 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:45:51 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
CG30053-RA 1..1008 19..1026 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:11:55 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
CG30053-RA 1..1008 19..1026 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:54:30 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
CG30053-RA 1..1008 19..1026 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:26:04 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
CG30053-RA 1..1088 1..1088 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:50:58 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
CG30053-RA 1..1088 1..1088 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:45:52 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
CG30053-RA 1..1008 19..1026 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:11:55 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
CG30053-RA 1..1088 1..1088 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:51:15 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12688733..12689438 383..1088 100 <- Minus
2R 12689495..12689876 1..382 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:51:15 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12688733..12689438 383..1088 100 <- Minus
2R 12689495..12689876 1..382 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:51:15 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12688733..12689438 383..1088 100 <- Minus
2R 12689495..12689876 1..382 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:50:58 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8576238..8576943 383..1088 100 <- Minus
arm_2R 8577000..8577381 1..382 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:53:02 Download gff for IP10855.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12689932..12690637 383..1088 100 <- Minus
2R 12690694..12691075 1..382 99   Minus

IP10855.hyp Sequence

Translation from 0 to 1025

> IP10855.hyp
LKGVRNMAEELKVFFEECRGQGFSAKEMLAVCQPLIWRIRLARIKKWFFI
LLPLMVIYLLWLCSDTFSWWLSALGRLVLIQILPLWDWRPYYHAKCLIPR
DQSVQEQAPSLGKAETLRQNCDLCEGLEGIGTVSNVSYSSLESEHLERGQ
PVIITDTGLQTDVFSLLEQIEKKSPQWLTSEPCDVSSNLLLRKLFNLEAA
LDKIHSWQGQTSNSWHLQLRNCQKKAVKSSRLFLDRPYYYPLHLAPYYSS
WLLAVHQQKRNQADIYVRGLVLIQQLSGHFEMVLHPKKPCNKGICPSLRM
RLNAGEGLIFTTDIWSLSYGLEKPHGKLTSLASIFEIDWQP*

IP10855.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG30053-PA 335 CG30053-PA 1..335 7..341 1794 100 Plus

IP10855.pep Sequence

Translation from 18 to 1025

> IP10855.pep
MAEELKVFFEECRGQGFSAKEMLAVCQPLIWRIRLARIKKWFFILLPLMV
IYLLWLCSDTFSWWLSALGRLVLIQILPLWDWRPYYHAKCLIPRDQSVQE
QAPSLGKAETLRQNCDLCEGLEGIGTVSNVSYSSLESEHLERGQPVIITD
TGLQTDVFSLLEQIEKKSPQWLTSEPCDVSSNLLLRKLFNLEAALDKIHS
WQGQTSNSWHLQLRNCQKKAVKSSRLFLDRPYYYPLHLAPYYSSWLLAVH
QQKRNQADIYVRGLVLIQQLSGHFEMVLHPKKPCNKGICPSLRMRLNAGE
GLIFTTDIWSLSYGLEKPHGKLTSLASIFEIDWQP*

IP10855.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13099-PA 332 GF13099-PA 1..332 1..335 1255 71.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22557-PA 335 GG22557-PA 1..335 1..335 1565 90.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19958-PA 334 GH19958-PA 4..333 1..334 973 56.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG30053-PA 335 CG30053-PA 1..335 1..335 1794 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19916-PA 337 GI19916-PA 4..336 1..334 947 55.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17732-PA 336 GL17732-PA 1..335 1..334 1108 65.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:33:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24896-PA 336 GA24896-PA 1..335 1..334 1137 65.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:33:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20341-PA 335 GM20341-PA 1..334 1..334 1668 94.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25819-PA 335 GD25819-PA 1..335 1..335 1670 94.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15083-PA 335 GJ15083-PA 7..334 4..334 878 56.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21690-PA 329 GK21690-PA 1..327 1..333 983 54.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13427-PA 333 GE13427-PA 1..333 1..333 1596 91.6 Plus