BDGP Sequence Production Resources |
Search the DGRC for IP11002
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 110 |
Well: | 2 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15256-RB |
Protein status: | IP11002.pep: gold |
Preliminary Size: | 1158 |
Sequenced Size: | 725 |
Gene | Date | Evidence |
---|---|---|
CG15256 | 2005-01-01 | Successful iPCR screen |
CG15256 | 2008-04-29 | Picked prior to 5.5 |
CG15256 | 2008-04-29 | Stopped prior to 5.5 |
725 bp assembled on 2009-07-20
GenBank Submission: BT088931.1
> IP11002.complete TCAAAATGGCCTGCAAAAAGAAAACCAAACTGTGGGAACCAATGACCAAG GATGAATTGAAGTCCACCACACAGGCGATGCTCGAGGAGGGCGCCAGGGG TTTAAGGACGATTTCTACGCAGCAGAAAAAGCTGGTCAACTTTCAGTCGT TCAACATGGATGATCCCCGTTACGGCATTTCCCTAATCGAGGACAACATG GAACCGCCCATGTTGTCGAGCTACACAAGGCAATACTCCCAGCCGTATCC AAATCGTTGTAAGCCCTTTGTTCAAAAGACGGAAACACCAGATCCCATAT TCAATCGAAGGCCGAAAAACGATTTTGAGTTTACCACAGGACTGGATTTT AAGTTTCTTGATGATCACATGCACAATCTTTCCGAATCACGCAAGAAAGT CAACTTCTTCCGGCAACTGAGGAATCAATCATTTCTTCTGTATTGACATG GTTAACAATTTTTCGAGCTAAAATTACAAAACAAAAACTATTAATTTGTA ACAATTTGACTCCATCATCGGCAAAGTTACGCAACGTGGCTCCTATTTTA AGAGCTTTCAGTTGTGCCATGATTATAAATTACCCCTCATTATGTTCCGG GAAAAATGTGTCAATTGCATTTTCCATTACCCCTTCGTTTTCGATAGAAA TCAATTAATTTTGCATAAATAAACTCGATTGGCAGCGTGAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15256-RB | 723 | CG15256-RB | 35..723 | 1..689 | 3445 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 15549824..15550093 | 420..689 | 1350 | 100 | Plus |
chr2L | 23010047 | chr2L | 15549510..15549768 | 164..422 | 1295 | 100 | Plus |
chr2L | 23010047 | chr2L | 15549196..15549358 | 1..163 | 800 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 15551095..15551364 | 420..689 | 1350 | 100 | Plus |
2L | 23513712 | 2L | 15550781..15551039 | 164..422 | 1295 | 100 | Plus |
2L | 23513712 | 2L | 15550467..15550629 | 1..163 | 815 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 15551095..15551364 | 420..689 | 1350 | 100 | Plus |
2L | 23513712 | 2L | 15550781..15551039 | 164..422 | 1295 | 100 | Plus |
2L | 23513712 | 2L | 15550467..15550629 | 1..163 | 815 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 15549196..15549358 | 1..163 | 99 | -> | Plus |
chr2L | 15549510..15549767 | 164..421 | 100 | -> | Plus |
chr2L | 15549826..15550093 | 422..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15256-RA | 1..422 | 6..430 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15256-RB | 1..441 | 6..446 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15256-RB | 1..441 | 6..446 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15256-RB | 1..441 | 6..446 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15256-RA | 1..422 | 6..430 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15256-RB | 17..705 | 1..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15256-RB | 96..784 | 1..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15256-RB | 96..784 | 1..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 15550467..15550629 | 1..163 | 100 | -> | Plus |
2L | 15550781..15551038 | 164..421 | 100 | -> | Plus |
2L | 15551097..15551364 | 422..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 15550467..15550629 | 1..163 | 100 | -> | Plus |
2L | 15550781..15551038 | 164..421 | 100 | -> | Plus |
2L | 15551097..15551364 | 422..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 15550467..15550629 | 1..163 | 100 | -> | Plus |
2L | 15550781..15551038 | 164..421 | 100 | -> | Plus |
2L | 15551097..15551364 | 422..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 15550467..15550629 | 1..163 | 100 | -> | Plus |
arm_2L | 15550781..15551038 | 164..421 | 100 | -> | Plus |
arm_2L | 15551097..15551364 | 422..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 15550781..15551038 | 164..421 | 100 | -> | Plus |
2L | 15551097..15551364 | 422..689 | 100 | Plus | |
2L | 15550467..15550629 | 1..163 | 100 | -> | Plus |
Translation from 2 to 445
> IP11002.hyp KMACKKKTKLWEPMTKDELKSTTQAMLEEGARGLRTISTQQKKLVNFQSF NMDDPRYGISLIEDNMEPPMLSSYTRQYSQPYPNRCKPFVQKTETPDPIF NRRPKNDFEFTTGLDFKFLDDHMHNLSESRKKVNFFRQLRNQSFLLY*
Translation from 2 to 445
> IP11002.pep KMACKKKTKLWEPMTKDELKSTTQAMLEEGARGLRTISTQQKKLVNFQSF NMDDPRYGISLIEDNMEPPMLSSYTRQYSQPYPNRCKPFVQKTETPDPIF NRRPKNDFEFTTGLDFKFLDDHMHNLSESRKKVNFFRQLRNQSFLLY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13865-PA | 158 | GF13865-PA | 1..144 | 2..143 | 561 | 72.2 | Plus |
Dana\GF15125-PA | 150 | GF15125-PA | 1..150 | 2..140 | 154 | 34.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG25164-PA | 242 | GG25164-PA | 1..138 | 2..139 | 716 | 94.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13762-PA | 185 | GH13762-PA | 1..132 | 2..132 | 375 | 57.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15256-PC | 146 | CG15256-PC | 1..146 | 2..147 | 780 | 100 | Plus |
CG15256-PB | 146 | CG15256-PB | 1..146 | 2..147 | 780 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17903-PA | 147 | GI17903-PA | 1..147 | 2..147 | 472 | 64.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26431-PA | 150 | GL26431-PA | 2..150 | 1..147 | 507 | 62.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13606-PA | 150 | GA13606-PA | 2..150 | 1..147 | 508 | 62.4 | Plus |
Dpse\GA26005-PA | 144 | GA26005-PA | 21..144 | 19..140 | 179 | 38.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16098-PA | 146 | GM16098-PA | 1..146 | 2..147 | 760 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24012-PA | 261 | GD24012-PA | 1..138 | 2..139 | 739 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17409-PA | 140 | GJ17409-PA | 1..140 | 2..140 | 439 | 61.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18138-PA | 150 | GK18138-PA | 1..150 | 2..147 | 461 | 60 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21045-PA | 234 | GE21045-PA | 1..138 | 2..139 | 730 | 96.4 | Plus |