Clone IP11023 Report

Search the DGRC for IP11023

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:110
Well:23
Vector:pOT2
Associated Gene/TranscriptCG1631-RA
Protein status:IP11023.pep: gold
Preliminary Size:1129
Sequenced Size:1132

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1631 2005-01-01 Successful iPCR screen
CG1631 2008-04-29 Release 5.5 accounting
CG1631 2008-08-15 Release 5.9 accounting
CG1631 2008-12-18 5.12 accounting

Clone Sequence Records

IP11023.complete Sequence

1132 bp (1132 high quality bases) assembled on 2005-02-26

GenBank Submission: BT023043

> IP11023.complete
AGACAGCCAGACAGTCAGACAGTCAGACAGTCTGAAACTAAGAGATACAG
CACATGGACGTACAGATATAGGAGCCGGGATTAGACACAATCGAACATGG
CCAGCGACCCTGCCAATTCCAGAGACCAGATCAACATAAACGCGGACGTT
TCGGATATTTCCACTAGCGAGAGTGAGCTAACCAGCGACGACTATACTAG
CGATAGCGAAGATGAGAGCTGCACAGTGGCCGATCCCGACACCAGTCCGC
AGACGAGCATGTACAGTCTGCTGTCGGCAGAATCAGACAGCGACTTGGAG
GAGGAGCAGGAGAATTTCTGCGAAGAGACTATTTCGCTGCTTGCCCACGA
GATCCTCTGCTGTGAGGGCGACAGTGAGGGCTCAGAGGTAGAGTCCGACG
GCGAGGACATCGACGAGGCCAGGGAATACGATATGTTTGGAGAATCCTCA
GAGTTTGGGCTTCCTACATACCGGCTCATGCTGAGCGACGAGGACGAAGA
TAATTCGAATGAGGTCGAAGTGGTAGGCAGTAATCCGTTCGTTGGCGAGA
CAATCTTCCTGCTAGAAAAGGATAAGGATCAACAGAGCGAGGAGAAGTCC
GAGTCAAAGGAGGAAGAAAAAATCTTCCAAATGGAGCTTTTTGAGTAGGG
CTGGGGTTGGTTGAATCGGCATCTCTGCAGGCGGTTTTTTTTTGGTTTTT
ACAGATATTCACATTCGATGATCATGGATCTAATATTTATGGAGGGCAAG
ATATGAGATGGATCCTTACCAGCAAACTCAATTTTCAGGATAAGGCTTAG
AGTAATTAGAAACGTACTATCCGAGTATATTTCTTTTTTAGCCAGATATC
AACATTTATGTATTCGCGCAAATTAACATACATACATTGTTTTATGCATT
AGGTGTACAAATGTCCCGAAGCGGCAAAAGTGTGACTCCCTCAGGGAACA
GACAATCCTGGCTTTTTGTGCGAGTCAACAGCATCCATAGATAGCAGTAT
ACAGGACGCAGTTAATGGCGACAGATAATGAGTGGAACACACTGCTGATC
CCAAGACTACAAACTTTATAAATTTGTCAAATTGTTTACAATAGAGTAAA
TTGATCGATACCATAAAAAAAAAAAAAAAAAA

IP11023.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG1631-RA 1240 CG1631-RA 65..1179 1..1115 5575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20193194..20194098 210..1114 4375 98.9 Plus
chrX 22417052 chrX 20192926..20193140 1..215 1060 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:04:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20327776..20328681 210..1115 4530 100 Plus
X 23542271 X 20327508..20327722 1..215 1060 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20312868..20313773 210..1115 4530 100 Plus
X 23527363 X 20312600..20312814 1..215 1060 99.5 Plus
Blast to na_te.dros performed on 2019-03-16 04:13:25 has no hits.

IP11023.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:14:14 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20192958..20193136 33..211 100 -> Plus
chrX 20193196..20194098 212..1114 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:47:59 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
CG1631-RA 1..552 97..648 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:11:01 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
CG1631-RA 1..552 97..648 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:21:51 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
CG1631-RA 1..552 97..648 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:55:42 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
CG1631-RA 1..552 97..648 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:31:50 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
CG1631-RA 1..552 97..648 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:04:36 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
CG1631-RA 15..1128 1..1114 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:11:01 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
CG1631-RA 15..1128 1..1114 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:21:51 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
CG1631-RA 65..1178 1..1114 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:55:43 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
CG1631-RA 15..1128 1..1114 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:31:50 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
CG1631-RA 65..1178 1..1114 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:14 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
X 20327508..20327718 1..211 100 -> Plus
X 20327778..20328680 212..1114 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:14 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
X 20327508..20327718 1..211 100 -> Plus
X 20327778..20328680 212..1114 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:14 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
X 20327508..20327718 1..211 100 -> Plus
X 20327778..20328680 212..1114 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:21:51 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20198535..20198745 1..211 100 -> Plus
arm_X 20198805..20199707 212..1114 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:30:55 Download gff for IP11023.complete
Subject Subject Range Query Range Percent Splice Strand
X 20312600..20312810 1..211 100 -> Plus
X 20312870..20313772 212..1114 100   Plus

IP11023.pep Sequence

Translation from 96 to 647

> IP11023.pep
MASDPANSRDQININADVSDISTSESELTSDDYTSDSEDESCTVADPDTS
PQTSMYSLLSAESDSDLEEEQENFCEETISLLAHEILCCEGDSEGSEVES
DGEDIDEAREYDMFGESSEFGLPTYRLMLSDEDEDNSNEVEVVGSNPFVG
ETIFLLEKDKDQQSEEKSESKEEEKIFQMELFE*

IP11023.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20243-PA 227 GF20243-PA 96..223 50..173 159 41.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19279-PA 196 GG19279-PA 1..196 1..183 337 50.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG1631-PA 183 CG1631-PA 1..183 1..183 932 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23021-PA 177 GM23021-PA 1..175 1..177 613 79.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:51:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17869-PA 168 GE17869-PA 1..166 1..173 310 54.2 Plus

IP11023.hyp Sequence

Translation from 96 to 647

> IP11023.hyp
MASDPANSRDQININADVSDISTSESELTSDDYTSDSEDESCTVADPDTS
PQTSMYSLLSAESDSDLEEEQENFCEETISLLAHEILCCEGDSEGSEVES
DGEDIDEAREYDMFGESSEFGLPTYRLMLSDEDEDNSNEVEVVGSNPFVG
ETIFLLEKDKDQQSEEKSESKEEEKIFQMELFE*

IP11023.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG1631-PA 183 CG1631-PA 1..183 1..183 932 100 Plus