Clone IP11101 Report

Search the DGRC for IP11101

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:111
Well:1
Vector:pOT2
Associated Gene/TranscriptCG15255-RA
Protein status:IP11101.pep: gold
Preliminary Size:1192
Sequenced Size:992

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15255 2005-01-01 Successful iPCR screen
CG15255 2008-04-29 Release 5.5 accounting
CG15255 2008-08-15 Release 5.9 accounting
CG15255 2008-12-18 5.12 accounting

Clone Sequence Records

IP11101.complete Sequence

992 bp (992 high quality bases) assembled on 2005-03-24

GenBank Submission: BT023011

> IP11101.complete
AGGAACTCAACTGGCAAGATGTCGAGGTCTGGAATAATATATGTTCTTCT
GCTGCAAGTGGTGCTTAACTCTGGCAAACCCCTGCCAGCAGGTGTCTACG
ATCCGGAGGAGGCAGGTGGATTTGTCGAGGGTGATATGATGCTAACGGAG
GAGCAACAAAGAAATCTGGAGCAGGGTGCTCCCAAGGCTCGCAATGGCCT
TATCAACACGGAAAAGAGATGGCCTGGAAATGTGGTGGTCTACAGGATAT
CAGATGACTTTGACACGGCGCACAAGAAGGCCATCCAAACTGGCATCGAT
ACCTTGGAGCTGCACACTTGTTTGAGGTTTAGGGAAGCCACCGATGAGGA
TAAGGCCTATTTGACGGTTACGGCCAAGTCTGGAGGATGCTACACTGCCG
TCGGCTACCAAGGTGCCCCGCAGGAAATGAATCTGGAAATATACCCGCTC
GGCGAAGGCTGTTTCCGGCCCGGAACGATCCTGCATGAGTTTATGCACGC
CTTGGGATTCTATCACCAACAGAGCTCGTCCATTCGAGATGATTTTATAA
ACGTGATCTACGAAAACATAGTGCCGGGCAAGGAATTCAATTTCCAAAAG
TATGCCGACACAGTCGTGACCGATTTCGAAGTTGGTTACGACTACGATAG
CTGTCTTCATTATCGACCAGGAGCCTTCTCTATCAACGGCGAGGATACTA
TAGTTCCCCTAGATTCCAGTGCGGTAATTGGACAGCGAGTGGGTCTTAGC
TCCAAGGACATCGATAAGATCAACATTATGTACAAGTGCCCCATTTTGCT
GTGATCCAAAATCAGGTAGACTATGTACTTGGTCAATTGTGATATGTATA
TATATTTATTCATATATCAGCCACCGACTGACGCGATTAGATCGGTTTTA
TTGATCTACGCTGCCATTGTCACCGCGGTCTGAACTATTTATAAAGAAGC
GTAAATTAAAGCCATACCCCTTAAAAAAAAAAAAAAAAAAAA

IP11101.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG15255-RA 1360 CG15255-RA 389..1360 1..972 4860 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15609444..15610415 972..1 4845 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:04:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:05:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15610730..15611703 974..1 4870 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:30:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15610730..15611703 974..1 4870 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:05:44 has no hits.

IP11101.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:06:30 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15609444..15610415 1..972 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:48:08 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15255-RA 1..786 19..804 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:07:14 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15255-RA 1..786 19..804 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:44:04 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15255-RA 1..786 19..804 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:52:11 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15255-RA 1..786 19..804 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:12:07 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15255-RA 1..786 19..804 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:57:11 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15255-RA 389..1192 1..804 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:07:14 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15255-RA 267..1238 1..972 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:44:04 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15255-RA 17..988 1..972 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:52:11 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15255-RA 389..1192 1..804 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:12:07 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
CG15255-RA 17..988 1..972 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:06:30 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15610732..15611703 1..972 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:06:30 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15610732..15611703 1..972 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:06:30 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15610732..15611703 1..972 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:44:04 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15610732..15611703 1..972 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:27:05 Download gff for IP11101.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15610732..15611703 1..972 100   Minus

IP11101.hyp Sequence

Translation from 0 to 803

> IP11101.hyp
RNSTGKMSRSGIIYVLLLQVVLNSGKPLPAGVYDPEEAGGFVEGDMMLTE
EQQRNLEQGAPKARNGLINTEKRWPGNVVVYRISDDFDTAHKKAIQTGID
TLELHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPL
GEGCFRPGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQK
YADTVVTDFEVGYDYDSCLHYRPGAFSINGEDTIVPLDSSAVIGQRVGLS
SKDIDKINIMYKCPILL*

IP11101.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:35:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG15255-PB 261 CG15255-PB 1..261 7..267 1378 100 Plus
CG15255-PA 261 CG15255-PA 1..261 7..267 1378 100 Plus
CG15254-PB 254 CG15254-PB 30..251 34..264 591 48.9 Plus
CG15254-PA 254 CG15254-PA 30..251 34..264 591 48.9 Plus
CG15253-PA 253 CG15253-PA 7..249 15..264 548 44.1 Plus

IP11101.pep Sequence

Translation from 18 to 803

> IP11101.pep
MSRSGIIYVLLLQVVLNSGKPLPAGVYDPEEAGGFVEGDMMLTEEQQRNL
EQGAPKARNGLINTEKRWPGNVVVYRISDDFDTAHKKAIQTGIDTLELHT
CLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFR
PGTILHEFMHALGFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVV
TDFEVGYDYDSCLHYRPGAFSINGEDTIVPLDSSAVIGQRVGLSSKDIDK
INIMYKCPILL*

IP11101.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13899-PA 260 GF13899-PA 1..260 1..261 1168 80.5 Plus
Dana\GF13897-PA 254 GF13897-PA 30..251 28..258 576 47.2 Plus
Dana\GF13868-PA 255 GF13868-PA 32..255 28..261 522 44.1 Plus
Dana\GF22400-PA 360 GF22400-PA 113..325 31..256 450 41.9 Plus
Dana\GF13898-PA 251 GF13898-PA 4..248 7..258 430 36.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24205-PA 261 GG24205-PA 1..261 1..261 1334 94.3 Plus
Dere\GG24203-PA 254 GG24203-PA 30..251 28..258 608 49.4 Plus
Dere\GG24202-PA 253 GG24202-PA 1..251 1..260 565 42.7 Plus
Dere\GG25167-PA 254 GG25167-PA 3..254 5..261 506 41.3 Plus
Dere\GG24204-PA 250 GG24204-PA 23..247 28..258 486 42.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13112-PA 262 GH13112-PA 23..262 21..261 1024 77.2 Plus
Dgri\GH13111-PA 252 GH13111-PA 9..250 6..259 627 47.7 Plus
Dgri\GH13110-PA 252 GH13110-PA 6..249 10..258 596 45.5 Plus
Dgri\GH13765-PA 256 GH13765-PA 33..254 28..259 538 44.9 Plus
Dgri\GH13764-PA 244 GH13764-PA 32..243 37..255 446 42.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG15255-PB 261 CG15255-PB 1..261 1..261 1378 100 Plus
CG15255-PA 261 CG15255-PA 1..261 1..261 1378 100 Plus
CG15254-PB 254 CG15254-PB 30..251 28..258 591 48.9 Plus
CG15254-PA 254 CG15254-PA 30..251 28..258 591 48.9 Plus
CG15253-PA 253 CG15253-PA 7..249 9..258 548 44.1 Plus
CG7631-PA 254 CG7631-PA 31..254 28..261 500 43.2 Plus
Semp1-PA 251 CG11864-PA 23..248 28..258 468 43.6 Plus
CG6696-PA 324 CG6696-PA 81..290 34..256 425 41.1 Plus
CG6763-PB 354 CG6763-PB 85..302 28..257 404 38.2 Plus
CG6763-PA 354 CG6763-PA 85..302 28..257 404 38.2 Plus
CG5715-PA 295 CG5715-PA 68..295 28..259 399 36.9 Plus
CG11865-PA 240 CG11865-PA 26..239 37..255 371 37.7 Plus
CG6974-PA 251 CG6974-PA 10..251 22..257 297 34.6 Plus
tok-PC 1464 CG6863-PC 518..721 57..258 290 32.5 Plus
tok-PA 1464 CG6863-PA 518..721 57..258 290 32.5 Plus
tok-PB 1464 CG6863-PB 518..721 57..258 290 32.5 Plus
CG10280-PA 356 CG10280-PA 104..338 25..257 275 32.1 Plus
CG10280-PB 362 CG10280-PB 110..344 25..257 275 32.1 Plus
tld-PA 1067 CG6868-PA 140..337 62..257 246 31.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22618-PA 263 GI22618-PA 21..263 19..261 953 70.5 Plus
Dmoj\GI22596-PA 264 GI22596-PA 40..261 28..258 611 48.5 Plus
Dmoj\GI22585-PA 254 GI22585-PA 7..251 9..258 575 44.7 Plus
Dmoj\GI22607-PA 249 GI22607-PA 21..241 28..258 572 46.8 Plus
Dmoj\GI22574-PA 262 GI22574-PA 31..258 18..257 543 46.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26591-PA 262 GL26591-PA 1..262 1..261 1081 74.9 Plus
Dper\GL26587-PA 253 GL26587-PA 29..250 28..258 607 50.2 Plus
Dper\GL26586-PA 250 GL26586-PA 28..249 28..258 573 47.2 Plus
Dper\GL26434-PA 250 GL26434-PA 3..250 4..261 523 40.8 Plus
Dper\GL26435-PA 260 GL26435-PA 37..257 28..258 471 41.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13605-PA 262 GA13605-PA 1..262 1..261 1093 75.3 Plus
Dpse\GA13604-PA 253 GA13604-PA 29..250 28..258 597 49.8 Plus
Dpse\GA13603-PA 250 GA13603-PA 19..249 19..258 577 46.3 Plus
Dpse\GA20493-PA 250 GA20493-PA 3..250 4..261 518 40.4 Plus
Dpse\GA19789-PA 322 GA19789-PA 80..292 31..256 444 41.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14306-PA 261 GM14306-PA 1..261 1..261 1385 98.5 Plus
Dsec\GM14287-PA 254 GM14287-PA 30..251 28..258 570 46.8 Plus
Dsec\GM16106-PA 254 GM16106-PA 3..254 5..261 510 41.7 Plus
Dsec\GM14297-PA 251 GM14297-PA 23..248 28..258 469 43.2 Plus
Dsec\GM22792-PA 324 GM22792-PA 78..290 31..256 438 41 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21951-PA 261 GD21951-PA 1..261 1..261 1387 98.9 Plus
Dsim\GD21949-PA 254 GD21949-PA 1..251 1..258 600 45.8 Plus
Dsim\GD21948-PA 253 GD21948-PA 28..251 28..260 562 46 Plus
Dsim\GD24016-PA 254 GD24016-PA 3..254 5..261 505 40.9 Plus
Dsim\GD21950-PA 251 GD21950-PA 23..248 28..258 473 43.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23181-PA 263 GJ23181-PA 8..263 6..261 984 69.6 Plus
Dvir\GJ23170-PA 252 GJ23170-PA 1..250 1..259 632 46.4 Plus
Dvir\GJ23159-PA 265 GJ23159-PA 12..262 1..258 613 47.3 Plus
Dvir\GJ23077-PA 255 GJ23077-PA 7..253 9..259 521 42.1 Plus
Dvir\GJ24375-PA 352 GJ24375-PA 75..292 28..257 447 42.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18907-PA 264 GK18907-PA 1..264 1..261 1055 75.4 Plus
Dwil\GK18246-PA 256 GK18246-PA 31..253 28..258 603 48.5 Plus
Dwil\GK18245-PA 251 GK18245-PA 11..251 9..258 581 46 Plus
Dwil\GK18143-PA 259 GK18143-PA 15..259 10..261 477 37.4 Plus
Dwil\GK24951-PA 316 GK24951-PA 70..282 31..256 429 40.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19399-PA 261 GE19399-PA 1..261 1..261 1325 94.3 Plus
Dyak\GE19397-PA 254 GE19397-PA 4..251 8..258 593 46.7 Plus
Dyak\BG:BACR44L22.3-PA 252 GE19396-PA 6..248 9..258 578 45.3 Plus
Dyak\GE21078-PA 254 GE21078-PA 31..254 28..261 514 44.1 Plus
Dyak\GE19398-PA 251 GE19398-PA 23..248 28..258 461 41.1 Plus