Clone IP11148 Report

Search the DGRC for IP11148

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:111
Well:48
Vector:pOT2
Associated Gene/TranscriptCG2053-RA
Protein status:IP11148.pep: gold
Preliminary Size:1182
Sequenced Size:1126

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2053 2005-01-01 Successful iPCR screen
CG2053 2008-04-29 Release 5.5 accounting
CG2053 2008-08-15 Release 5.9 accounting
CG2053 2008-12-18 5.12 accounting

Clone Sequence Records

IP11148.complete Sequence

1126 bp (1126 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022983

> IP11148.complete
ATTAATTACTCCTCACCAAGCAGAACTTAAATGAGTGCCCCAAACATGGA
TTGTGAACAGCGCGGCGATATAGATAGCGTCTTCGGCTGGATCGCCAATC
TTTGCAACAAAGAAACGCGTCTCTGGGCGATGCTGGAGCTATTCGAAAGG
CGCACCCACATTGACAGCCTAGGACTCTTGCTATGGCATTCCTTTGGAGC
TGTGAGTGGCTTGCTACAAGAGATTGTGTCAATATATCCGGCCATTTATC
AAGAAATTGAATTAACCGGCCAACAGTCGCACCGGATTTGCACTGCCATT
GGGCTGATTCAGGCTATGGCATCACATCCCTTCATTGGTATTCAACTCAT
ACGATGCCAATTCATGTGCTATTTGATGCCATTGCTTAAAATGACTTCTC
AAACTCGCGCCGTTGAGCATGTTCGTCTCTCTGTCTTGGGCGTCATTTGC
GGTCTACTGAAATCAGATCATCCGGAGATCGTATCTTATTTTTTGGGCAC
TGAATTAATTCCACTTACCCTGCGGCAGCTGGAGTTTGGTACCACAATGA
GTAAGGTGCTCTGTGCATTTGTCTTGTACCGCACCTTAGAACATGAAGTG
GGCTTAAAGTTTGCCAGTCGAAGACTGGCACGAAAGCTGCATCTGATCCA
TACTTTGGCCAGGGTTGTGCACCAACTCACACTGGAACCGGAGCCTAGGG
TCCTTAAACATGTAGTAAGGATCTATTCTCGTCTGGCTGATCATCCCCAA
AATCTGGAGCTGATCCTTAAGCTATTGCCGGCTCAGATTCGGAACGGCTA
TTTTTGCCAGGAAGGTTTAGTGGGCTTCGAGAGCGCTTCTCTAGAGCTAG
CTGATCTTAACCGTAAGCTCAGTAAAAATGAGGAAAAGGACAAGGTTTGT
GATGATGCCATGCCGGAAAACCATTGAAGCTAAATTTCACGCCTCCTTAG
TTTTCCTTCCCCTAATTGTCCTAATCAATGCATACAATTGGTGAACCAAT
CAGATGTTTTATTTGGTTGCTTCTGGATATCTTTGGTTGGAGGATATGTA
AGGGTTCTCTTGAAGCATTAAGTTAGAACAATGCAATAAACAGATCGTAA
ATATTTTGAAAAAAAAAAAAAAAAAA

IP11148.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG2053-RA 1375 CG2053-RA 124..1232 1..1109 5545 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 27860539..27861433 1..895 4475 100 Plus
chr3R 27901430 chr3R 27861483..27861696 895..1108 1070 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:04:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 32038453..32039347 1..895 4475 100 Plus
3R 32079331 3R 32039397..32039611 895..1109 1075 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 31779284..31780178 1..895 4475 100 Plus
3R 31820162 3R 31780228..31780442 895..1109 1075 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:20:42 has no hits.

IP11148.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:21:31 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 27860539..27861433 1..895 100 -> Plus
chr3R 27861484..27861696 896..1108 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:48:18 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
CG2053-RA 1..897 31..927 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:16:57 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
CG2053-RA 1..897 31..927 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:24:56 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
CG2053-RA 1..897 31..927 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:01:20 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
CG2053-RA 1..897 31..927 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:03:06 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
CG2053-RA 1..897 31..927 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:16:19 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
CG2053-RA 81..1182 1..1102 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:16:57 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
CG2053-RA 81..1182 1..1102 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:24:56 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
CG2053-RA 81..1182 1..1102 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:01:20 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
CG2053-RA 81..1182 1..1102 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:03:06 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
CG2053-RA 124..1231 1..1108 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:21:31 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
3R 32038453..32039347 1..895 100 -> Plus
3R 32039398..32039610 896..1108 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:21:31 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
3R 32038453..32039347 1..895 100 -> Plus
3R 32039398..32039610 896..1108 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:21:31 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
3R 32038453..32039347 1..895 100 -> Plus
3R 32039398..32039610 896..1108 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:24:56 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27864175..27865069 1..895 100 -> Plus
arm_3R 27865120..27865332 896..1108 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:37:03 Download gff for IP11148.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31779284..31780178 1..895 100 -> Plus
3R 31780229..31780441 896..1108 100   Plus

IP11148.pep Sequence

Translation from 30 to 926

> IP11148.pep
MSAPNMDCEQRGDIDSVFGWIANLCNKETRLWAMLELFERRTHIDSLGLL
LWHSFGAVSGLLQEIVSIYPAIYQEIELTGQQSHRICTAIGLIQAMASHP
FIGIQLIRCQFMCYLMPLLKMTSQTRAVEHVRLSVLGVICGLLKSDHPEI
VSYFLGTELIPLTLRQLEFGTTMSKVLCAFVLYRTLEHEVGLKFASRRLA
RKLHLIHTLARVVHQLTLEPEPRVLKHVVRIYSRLADHPQNLELILKLLP
AQIRNGYFCQEGLVGFESASLELADLNRKLSKNEEKDKVCDDAMPENH*

IP11148.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20275-PA 304 GF20275-PA 27..267 15..258 476 40.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11840-PA 299 GG11840-PA 1..299 1..298 1451 91.3 Plus
Dere\GG19241-PA 297 GG19241-PA 22..260 17..258 478 40.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:19:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24151-PA 304 GH24151-PA 23..263 17..260 475 40.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG2053-PB 298 CG2053-PB 1..298 1..298 1543 100 Plus
CG2053-PA 298 CG2053-PA 1..298 1..298 1543 100 Plus
Rcd-1-PA 304 CG14213-PA 21..267 9..258 469 40 Plus
Rcd-1-PB 304 CG14213-PB 21..267 9..258 469 40 Plus
Rcd-1-PC 301 CG14213-PC 29..264 20..258 457 41 Plus
Rcd-1r-PA 290 CG9573-PA 6..258 3..258 343 34.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:19:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21711-PA 306 GI21711-PA 23..265 15..260 485 40.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:19:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23452-PA 331 GL23452-PA 1..295 1..296 775 50.3 Plus
Dper\GL27101-PA 296 GL27101-PA 1..259 1..258 490 40.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:19:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27260-PA 302 GA27260-PA 1..290 1..291 770 50.2 Plus
Dpse\GA12828-PA 296 GA12828-PA 1..259 1..258 490 40.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:19:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16460-PA 298 GM16460-PA 1..298 1..298 1528 95.6 Plus
Dsec\GM22976-PA 299 GM22976-PA 22..262 15..258 479 40.6 Plus
Dsec\GM12572-PA 297 GM12572-PA 7..258 4..258 344 32.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:19:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21611-PA 298 GD21611-PA 1..298 1..298 1522 95.6 Plus
Dsim\GD22367-PA 297 GD22367-PA 7..258 4..258 326 30.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:19:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15574-PA 302 GJ15574-PA 1..261 1..260 483 39.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12164-PA 295 GK12164-PA 1..282 1..288 854 59.4 Plus
Dwil\GK16372-PA 304 GK16372-PA 22..262 15..258 479 40.6 Plus
Dwil\GK13072-PA 269 GK13072-PA 6..254 9..254 413 36 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10974-PA 299 GE10974-PA 1..299 1..298 1456 91.6 Plus
Dyak\GE15860-PA 298 GE15860-PA 23..261 17..258 478 40.9 Plus

IP11148.hyp Sequence

Translation from 30 to 926

> IP11148.hyp
MSAPNMDCEQRGDIDSVFGWIANLCNKETRLWAMLELFERRTHIDSLGLL
LWHSFGAVSGLLQEIVSIYPAIYQEIELTGQQSHRICTAIGLIQAMASHP
FIGIQLIRCQFMCYLMPLLKMTSQTRAVEHVRLSVLGVICGLLKSDHPEI
VSYFLGTELIPLTLRQLEFGTTMSKVLCAFVLYRTLEHEVGLKFASRRLA
RKLHLIHTLARVVHQLTLEPEPRVLKHVVRIYSRLADHPQNLELILKLLP
AQIRNGYFCQEGLVGFESASLELADLNRKLSKNEEKDKVCDDAMPENH*

IP11148.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG2053-PB 298 CG2053-PB 1..298 1..298 1543 100 Plus
CG2053-PA 298 CG2053-PA 1..298 1..298 1543 100 Plus
Rcd-1-PA 304 CG14213-PA 21..267 9..258 469 40 Plus
Rcd-1-PB 304 CG14213-PB 21..267 9..258 469 40 Plus
Rcd-1-PC 301 CG14213-PC 29..264 20..258 457 41 Plus