Clone IP11180 Report

Search the DGRC for IP11180

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:111
Well:80
Vector:pOT2
Associated Gene/TranscriptCG31525-RA
Protein status:IP11180.pep: gold
Preliminary Size:951
Sequenced Size:1191

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31525 2005-01-01 Successful iPCR screen
CG31525 2008-04-29 Release 5.5 accounting
CG31525 2008-08-15 Release 5.9 accounting
CG31525 2008-12-18 5.12 accounting

Clone Sequence Records

IP11180.complete Sequence

1191 bp (1191 high quality bases) assembled on 2005-02-26

GenBank Submission: BT022951

> IP11180.complete
GGAACTCCTAAAAACGAAACCAATCATAGTTGCCTTTTCGATATCAATCC
ACAATCGTCATATGATTGTAACATATTGAAAAATCAAGTTTACAAAATCA
CTTCCCGTTAACCAAATAATAATAAAAAAAAAAAACGAAATGCCAAAAAA
AGTGATCACAAGGCGTCAACGCAAAGCTGCAGAGTCCCGGCTAAGGGCCA
CAAAGGAAGCAAGTCAGAAGAATTGGCCCAGGATAATAGAAGTTATACCG
ATTCCCCCAATCTCTCGTTCGACTAATTCAACTAGCTCAAAGGAAACATA
CTCAAAGAAAAAAGATATAGGTATGTCCCAGACGACTTTAGATGGAAAGA
ATGAGAAGGAAAAAACTCCGTCTTTGGAACAGTCAATCCACGAATCCGAA
AAGAAAATTCAGCTGTGTGATGCTCTGCAAAAAATTCGATTAACTAGTCA
CAAGAAAACCTTCTTGTCGGAAATAAAAAAGAAGGCTTTTGACGCGGAAC
AATTCCAAAATACCACTTCATCCGGATATGATAAGGACAATAAATTTATT
GCACTGGTTCCAAGGAACACCAATAAAGGGGCCAATAAAACTCCAAACTC
CAGCGTGCCATTGATGTCCAAATTTTGCGAACAAATTAAGTCGCACTTCC
ACTCTGTCCTGCCGACACGAAACCTACTCTGTTCAAAATCCCCAATTCCG
ATGGAAAAGGAACCTGATCACGGTGCAGATTTGCTGTTGCCACGACCAGT
TTTCAATAACCTGGAGAATGAAGTTAAAGTCAAATGCTTCAAGCCTTCTG
AGCTAGCTAGAAATCCCAAACCGCCTATTAGGATTTTTGGCATAACAGGC
TTCTTTGTCCTAACTGGTACCAATGCTCAGTTGTCTTTTCACATCGGCCA
ACTTGCGATCAGAGGCGTTAGTGTCCAATCATGTATACATCTGCAAACCG
AAATGATGGATAAGGTGGAGGAACAACTCGCTAAGCTGACTATGGACCGC
AAAAGAATCCTCAACAAAATGCATAACAAGCATGCAACACTTGCACAACG
TCGAGCTCCGCCAGAGACACATCATCAGGGTAAAAATTAAACATAGGCAT
TGACATTAAAATTAAATTACAATGTAAATAAATACCGAAACCGGAATAAA
AATGTAGCTTTAGAAAGCCTTAAAAAAAAAAAAAAAAAAAA

IP11180.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:42:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG31525-RA 1176 CG31525-RA 1..1173 1..1173 5865 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 252749..253919 1..1171 5855 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:04:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4427030..4428202 1..1173 5865 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4167861..4169033 1..1173 5865 100 Plus
Blast to na_te.dros performed 2019-03-16 13:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 6074..6169 60..153 123 62.9 Plus

IP11180.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:36:45 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 252749..253919 1..1171 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:48:28 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
CG31525-RA 1..951 140..1090 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:10:52 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
CG31525-RA 1..951 140..1090 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:44:36 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
CG31525-RA 1..951 140..1090 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:55:33 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
CG31525-RA 1..951 140..1090 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:14:59 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
CG31525-RA 1..951 140..1090 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:04:15 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
CG31525-RA 1..1171 1..1171 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:10:52 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
CG31525-RA 1..1171 1..1171 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:44:36 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
CG31525-RA 1..1171 1..1171 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:55:33 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
CG31525-RA 1..1171 1..1171 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:14:59 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
CG31525-RA 1..1171 1..1171 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:36:45 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4427030..4428200 1..1171 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:36:45 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4427030..4428200 1..1171 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:36:45 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4427030..4428200 1..1171 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:44:36 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 252752..253922 1..1171 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:30:46 Download gff for IP11180.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4167861..4169031 1..1171 100   Plus

IP11180.pep Sequence

Translation from 139 to 1089

> IP11180.pep
MPKKVITRRQRKAAESRLRATKEASQKNWPRIIEVIPIPPISRSTNSTSS
KETYSKKKDIGMSQTTLDGKNEKEKTPSLEQSIHESEKKIQLCDALQKIR
LTSHKKTFLSEIKKKAFDAEQFQNTTSSGYDKDNKFIALVPRNTNKGANK
TPNSSVPLMSKFCEQIKSHFHSVLPTRNLLCSKSPIPMEKEPDHGADLLL
PRPVFNNLENEVKVKCFKPSELARNPKPPIRIFGITGFFVLTGTNAQLSF
HIGQLAIRGVSVQSCIHLQTEMMDKVEEQLAKLTMDRKRILNKMHNKHAT
LAQRRAPPETHHQGKN*

IP11180.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18216-PA 403 GF18216-PA 304..398 218..316 208 44.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12417-PA 322 GG12417-PA 1..310 1..307 840 60.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19052-PA 449 GH19052-PA 346..438 212..305 185 43.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG31525-PA 316 CG31525-PA 1..316 1..316 1634 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10686-PA 500 GI10686-PA 415..489 231..305 184 42.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16300-PA 405 GA16300-PA 176..397 130..309 168 29.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10757-PA 322 GM10757-PA 1..322 1..316 1250 76.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19732-PA 323 GD19732-PA 1..323 1..316 1214 76.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10431-PA 515 GJ10431-PA 428..504 229..305 166 40.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13536-PA 423 GK13536-PA 286..364 227..305 149 39.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18066-PA 322 GE18066-PA 1..303 1..303 882 60.5 Plus

IP11180.hyp Sequence

Translation from 139 to 1089

> IP11180.hyp
MPKKVITRRQRKAAESRLRATKEASQKNWPRIIEVIPIPPISRSTNSTSS
KETYSKKKDIGMSQTTLDGKNEKEKTPSLEQSIHESEKKIQLCDALQKIR
LTSHKKTFLSEIKKKAFDAEQFQNTTSSGYDKDNKFIALVPRNTNKGANK
TPNSSVPLMSKFCEQIKSHFHSVLPTRNLLCSKSPIPMEKEPDHGADLLL
PRPVFNNLENEVKVKCFKPSELARNPKPPIRIFGITGFFVLTGTNAQLSF
HIGQLAIRGVSVQSCIHLQTEMMDKVEEQLAKLTMDRKRILNKMHNKHAT
LAQRRAPPETHHQGKN*

IP11180.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG31525-PA 316 CG31525-PA 1..316 1..316 1634 100 Plus