Clone IP11207 Report

Search the DGRC for IP11207

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:112
Well:7
Vector:pOT2
Associated Gene/TranscriptTwdlX-RA
Protein status:IP11207.pep: gold
Preliminary Size:1041
Sequenced Size:1365

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32571 2005-01-01 Successful iPCR screen
TwdlX 2008-04-29 Release 5.5 accounting
TwdlX 2008-08-15 Release 5.9 accounting
TwdlX 2008-12-18 5.12 accounting

Clone Sequence Records

IP11207.complete Sequence

1365 bp (1365 high quality bases) assembled on 2005-02-26

GenBank Submission: BT022947

> IP11207.complete
CTCCAGGGCGACAGTTGCTTCTCCTCCTCATCCATCCATCCATTCCTACC
AAGTCCAACATGAAGCAGTTTGTGGTTTTGGCCGTTCTGGCTGTGATTGG
CGGTTCCCTGGCCGCTCCTCGTCCGGATGTCAGCCATCTGGCGGGATACA
GCTACCAGGCTGGTGGTTACAATGGCAACCTGGTGGCCAATCAGGTGCTC
AGTGCTCCCTTGACCACGGTGACCACCTCGTACCAGCCCACGGCAGCTGG
TACCAACTACTACAGTTCGGCACCATCCATTGGTCAGCTTAATCTGGGCT
CCTCCGGTTCTTCTGGTGTGGTCAACTACCAGGTGGGCGGCTCTGGCTCG
TCCAGCTATCAAGTGGGCTCCTCCTCTGTCGGCGGTGGCATCGTGAACGA
TAACATTGGCCTGGCCGGTCTGCAGCCCGGACCCACCATCAACTACAACG
AGCAGGAGTCGTACATCAGCCATCTGGCCAACTTCCAGCCCGCCCAGATC
AACAAGCACTTCTACATCCACAGTGCTCCCGAGGATCACGATGAGCAGCA
GATCGTGCGCTATGTGAATGTGGGCAGGCCCCAGAAGAACTACCGTGTGG
TCTTCATCAACGCTCCCACATCCACCGCCAGCAAGGCCAAGATCATTGCC
AACGTGGCGCCCGTTGAGGAGAAGACTGCCATCTATGTCCTGTCCAAGAA
GTCTAATGCCCTGGATGTCACCGCCGAGGTGGTCACTCAGCGCCCTGTGG
CCAACAAGCCGGAGGTGTTCTTCGTCAAGTATAAGACTCCTCAGGAGGCG
GCCCATGCCCAGCAGACCATTCAGGCCAACTATGATGCTCTGGGTGGAAG
CTCTGAGACCAGCAACGAGGGTGTGATTCCCGTTTCCTCCGTGATCGGTA
GCCTGGGCGATAATGGAGCCTCCGGAGTGTTGACCGATGCCAGCGGTAGC
GTGAACATTGTGGGCACCGGCGGAGTTCCAACCGTGGATGCTGGAGCCAG
CTATGATGCCGAGGGCAGCCAGCGCCAGGTGATCAGCACCGTGACTACCG
GCACCAATGCCCAGGCTACCTATCTGCCCGTGAAGCCGGTGAGGAAGTAG
GTGAATCGCCTGGATTCCATTACATAATCCGCATCCACTGCCAATGAATG
ACAGACACAATCCAGCCTCGGAAGATTCGGACTGGATGGGAAAGCCCCTT
GGGTTTGGGGCCCATTACAGTGGAATCTCGCCGGGGAAACCTTTGCGATT
TTTCCTATTTAGTTTTGCCTTCGGCACTAATTCATATTTTTTGTGTATAA
TTTTTTTTTTTTTTTTAAATAAAATTTAAGAGTTCTCATAGGCATTCAAA
AAAAAAAAAAAAAAA

IP11207.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlX-RA 1414 TwdlX-RA 62..1413 1..1353 6725 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16620904..16621655 74..825 3745 99.9 Plus
chrX 22417052 chrX 16621761..16622281 825..1347 2490 98.9 Plus
chrX 22417052 chrX 16620763..16620838 1..76 380 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:05:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16731252..16732003 74..825 3760 100 Plus
X 23542271 X 16732109..16732636 825..1353 2595 99.8 Plus
X 23542271 X 16731111..16731186 1..76 380 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16739350..16740101 74..825 3760 100 Plus
X 23527363 X 16740207..16740734 825..1353 2605 99.8 Plus
X 23527363 X 16739209..16739284 1..76 380 100 Plus
X 23527363 X 16743655..16743691 751..787 140 91.8 Plus
Blast to na_te.dros performed on 2019-03-15 11:53:47 has no hits.

IP11207.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:54:57 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16620763..16620836 1..74 100 -> Plus
chrX 16620905..16621655 75..825 99 -> Plus
chrX 16621762..16622281 826..1347 92   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:48:32 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlX-RA 1..1041 60..1100 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:10:53 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlX-RA 1..1041 60..1100 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:33:58 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlX-RA 1..1041 60..1100 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:55:34 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlX-RA 1..1041 60..1100 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:44:38 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlX-RA 1..1041 60..1100 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:04:18 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlX-RA 1..1041 60..1100 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:10:53 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlX-RA 21..1366 1..1347 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:33:58 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlX-RA 21..1366 1..1347 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:55:34 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlX-RA 1..1041 60..1100 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:44:38 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlX-RA 21..1366 1..1347 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:54:57 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
X 16731111..16731184 1..74 100 -> Plus
X 16731253..16732003 75..825 100 -> Plus
X 16732110..16732630 826..1347 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:54:57 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
X 16731111..16731184 1..74 100 -> Plus
X 16731253..16732003 75..825 100 -> Plus
X 16732110..16732630 826..1347 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:54:57 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
X 16731111..16731184 1..74 100 -> Plus
X 16731253..16732003 75..825 100 -> Plus
X 16732110..16732630 826..1347 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:33:58 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16625144..16625217 1..74 100 -> Plus
arm_X 16625286..16626036 75..825 100 -> Plus
arm_X 16626143..16626663 826..1347 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:30:47 Download gff for IP11207.complete
Subject Subject Range Query Range Percent Splice Strand
X 16739351..16740101 75..825 100 -> Plus
X 16740208..16740728 826..1347 99   Plus
X 16739209..16739282 1..74 100 -> Plus

IP11207.hyp Sequence

Translation from 2 to 1099

> IP11207.hyp
PGRQLLLLLIHPSIPTKSNMKQFVVLAVLAVIGGSLAAPRPDVSHLAGYS
YQAGGYNGNLVANQVLSAPLTTVTTSYQPTAAGTNYYSSAPSIGQLNLGS
SGSSGVVNYQVGGSGSSSYQVGSSSVGGGIVNDNIGLAGLQPGPTINYNE
QESYISHLANFQPAQINKHFYIHSAPEDHDEQQIVRYVNVGRPQKNYRVV
FINAPTSTASKAKIIANVAPVEEKTAIYVLSKKSNALDVTAEVVTQRPVA
NKPEVFFVKYKTPQEAAHAQQTIQANYDALGGSSETSNEGVIPVSSVIGS
LGDNGASGVLTDASGSVNIVGTGGVPTVDAGASYDAEGSQRQVISTVTTG
TNAQATYLPVKPVRK*

IP11207.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlX-PA 346 CG32571-PA 1..346 20..365 1747 100 Plus
Twdlalpha-PA 388 CG32574-PA 42..352 33..349 447 39.2 Plus
TwdlV-PA 251 CG14640-PA 21..248 108..359 406 40.9 Plus
TwdlY-PA 247 CG32570-PA 35..213 115..301 378 45.7 Plus
TwdlG-PC 278 CG14643-PC 69..258 112..309 352 43.5 Plus

IP11207.pep Sequence

Translation from 59 to 1099

> IP11207.pep
MKQFVVLAVLAVIGGSLAAPRPDVSHLAGYSYQAGGYNGNLVANQVLSAP
LTTVTTSYQPTAAGTNYYSSAPSIGQLNLGSSGSSGVVNYQVGGSGSSSY
QVGSSSVGGGIVNDNIGLAGLQPGPTINYNEQESYISHLANFQPAQINKH
FYIHSAPEDHDEQQIVRYVNVGRPQKNYRVVFINAPTSTASKAKIIANVA
PVEEKTAIYVLSKKSNALDVTAEVVTQRPVANKPEVFFVKYKTPQEAAHA
QQTIQANYDALGGSSETSNEGVIPVSSVIGSLGDNGASGVLTDASGSVNI
VGTGGVPTVDAGASYDAEGSQRQVISTVTTGTNAQATYLPVKPVRK*

IP11207.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22658-PA 345 GF22658-PA 1..345 1..346 1489 84.5 Plus
Dana\GF22662-PA 385 GF22662-PA 1..308 1..295 408 40 Plus
Dana\GF16822-PA 238 GF16822-PA 72..211 147..285 343 52.4 Plus
Dana\GF18197-PA 263 GF18197-PA 89..260 145..340 311 47.4 Plus
Dana\GF22660-PA 227 GF22660-PA 70..197 133..282 300 45.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19072-PA 322 GG19072-PA 1..322 1..346 1576 89.3 Plus
Dere\GG19076-PA 427 GG19076-PA 124..332 90..295 398 43.3 Plus
Dere\GG19073-PA 247 GG19073-PA 78..213 147..282 359 54 Plus
Dere\GG11741-PA 269 GG11741-PA 104..249 147..290 350 50.7 Plus
Dere\GG12230-PA 252 GG12230-PA 76..239 145..314 307 51.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11915-PA 620 GH11915-PA 355..616 102..345 922 67.3 Plus
Dgri\GH21845-PA 288 GH21845-PA 109..252 147..289 369 51.4 Plus
Dgri\GH11916-PA 242 GH11916-PA 75..217 147..289 363 53.5 Plus
Dgri\GH11918-PA 355 GH11918-PA 164..304 142..282 359 51.4 Plus
Dgri\GH19057-PA 287 GH19057-PA 83..221 145..283 353 56.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlX-PA 346 CG32571-PA 1..346 1..346 1747 100 Plus
Twdlalpha-PA 388 CG32574-PA 42..352 14..330 447 39.2 Plus
TwdlV-PA 251 CG14640-PA 21..248 89..340 406 40.9 Plus
TwdlY-PA 247 CG32570-PA 35..213 96..282 378 45.7 Plus
TwdlG-PC 278 CG14643-PC 69..258 93..290 352 43.5 Plus
TwdlG-PB 278 CG14643-PB 69..258 93..290 352 43.5 Plus
TwdlG-PA 278 CG14643-PA 69..258 93..290 352 43.5 Plus
TwdlW-PA 308 CG4060-PA 129..265 147..282 300 44.5 Plus
TwdlZ-PB 210 CG32569-PB 35..173 147..282 295 45.3 Plus
TwdlL-PB 279 CG6447-PB 15..247 57..274 290 33.5 Plus
TwdlL-PA 285 CG6447-PA 21..253 57..274 290 33.5 Plus
TwdlF-PA 354 CG14639-PA 135..347 143..346 289 38.4 Plus
TwdlB-PA 286 CG6478-PA 21..253 57..274 285 33.1 Plus
TwdlM-PA 288 CG5468-PA 21..258 57..275 280 33.5 Plus
TwdlN-PA 309 CG5476-PA 1..272 1..272 274 30.4 Plus
Tb-PA 283 CG5480-PA 19..218 64..275 253 35.9 Plus
TwdlO-PA 229 CG6452-PA 18..185 89..272 235 34.4 Plus
TwdlP-PA 220 CG14240-PA 30..183 115..272 228 36.9 Plus
TwdlQ-PA 245 CG14250-PA 74..205 146..275 228 38.6 Plus
TwdlK-PA 247 CG6460-PA 19..211 64..272 225 33.8 Plus
TwdlD-PA 256 CG14243-PA 78..231 146..297 216 35.1 Plus
TwdlJ-PB 274 CG5471-PB 22..214 64..272 214 33.3 Plus
TwdlH-PA 241 CG31080-PA 77..209 145..275 204 39.1 Plus
TwdlR-PA 325 CG31081-PA 22..198 93..283 200 35.5 Plus
TwdlT-PA 286 CG5812-PA 1..284 1..312 191 25.7 Plus
TwdlC-PA 360 CG14254-PA 104..231 128..248 183 32.8 Plus
TwdlE-PA 197 CG14534-PA 57..160 143..246 176 37.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14656-PA 374 GI14656-PA 138..329 115..303 387 45.6 Plus
Dmoj\GI21932-PA 273 GI21932-PA 95..263 147..307 380 49.4 Plus
Dmoj\GI10848-PA 268 GI10848-PA 86..234 147..290 354 54.4 Plus
Dmoj\GI14654-PA 562 GI14654-PA 395..537 147..289 346 51.4 Plus
Dmoj\GI23141-PA 328 GI23141-PA 134..270 147..282 298 43.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26860-PA 300 GL26860-PA 1..300 1..346 1061 66 Plus
Dper\GL12334-PA 296 GL12334-PA 131..275 147..289 373 53.1 Plus
Dper\GL26861-PA 223 GL26861-PA 36..173 147..282 310 47.1 Plus
Dper\GL26862-PA 259 GL26862-PA 102..213 169..282 303 57.4 Plus
Dper\GL12309-PA 437 GL12309-PA 265..400 147..285 301 58.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16998-PA 344 GA16998-PA 1..344 1..346 1384 79.6 Plus
Dpse\GA17001-PA 359 GA17001-PA 148..288 142..282 384 54.2 Plus
Dpse\GA13142-PA 296 GA13142-PA 131..275 147..289 374 53.1 Plus
Dpse\GA16997-PA 254 GA16997-PA 66..234 133..308 367 48 Plus
Dpse\GA22640-PA 217 GA22640-PA 36..173 147..282 312 47.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13462-PA 346 GM13462-PA 1..346 1..346 1744 98.3 Plus
Dsec\GM20554-PA 382 GM20554-PA 156..308 142..295 385 52.3 Plus
Dsec\GM13463-PA 247 GM13463-PA 78..213 147..282 361 54.7 Plus
Dsec\GM10719-PA 281 GM10719-PA 116..261 147..290 350 50.7 Plus
Dsec\GM10739-PA 254 GM10739-PA 80..251 145..340 309 47.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17302-PA 346 GD17302-PA 1..346 1..346 1753 98.8 Plus
Dsim\GD17305-PA 405 GD17305-PA 113..323 81..295 401 46.6 Plus
Dsim\GD19694-PA 278 GD19694-PA 113..258 147..290 349 50.7 Plus
Dsim\GD19711-PA 255 GD19711-PA 81..252 145..340 309 47.4 Plus
Dsim\GD17303-PA 336 GD17303-PA 162..300 147..282 299 46 Plus
Dsim\GD17303-PA 336 GD17303-PA 78..143 147..212 192 59.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19305-PA 387 GJ19305-PA 1..383 1..345 1065 60.5 Plus
Dvir\GJ14455-PA 269 GJ14455-PA 91..223 147..279 396 58.6 Plus
Dvir\GJ19308-PA 368 GJ19308-PA 132..324 109..289 379 43.8 Plus
Dvir\GJ14291-PA 281 GJ14291-PA 1..272 1..308 362 36 Plus
Dvir\GJ19306-PA 246 GJ19306-PA 79..214 147..282 352 54 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25414-PA 339 GK25414-PA 1..339 1..346 1173 71.2 Plus
Dwil\GK25415-PA 249 GK25415-PA 84..219 147..282 360 54.7 Plus
Dwil\GK22650-PA 292 GK22650-PA 121..274 147..304 349 50 Plus
Dwil\GK22519-PA 265 GK22519-PA 90..248 145..306 328 55.6 Plus
Dwil\GK25418-PA 366 GK25418-PA 157..297 142..282 326 55.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17617-PA 351 GE17617-PA 1..351 1..346 1588 92 Plus
Dyak\GE17621-PA 429 GE17621-PA 162..348 118..295 390 45.5 Plus
Dyak\GE17618-PA 247 GE17618-PA 78..213 147..282 362 54.7 Plus
Dyak\GE25368-PA 265 GE25368-PA 85..245 132..290 344 47.9 Plus
Dyak\GE17619-PA 210 GE17619-PA 35..174 147..283 305 46.4 Plus