Clone IP11229 Report

Search the DGRC for IP11229

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:112
Well:29
Vector:pOT2
Associated Gene/TranscriptCG4520-RA
Protein status:IP11229.pep: gold
Preliminary Size:1171
Sequenced Size:1313

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4520 2005-01-01 Successful iPCR screen
CG4520 2008-04-29 Release 5.5 accounting
CG4520 2008-08-15 Release 5.9 accounting
CG4520 2008-12-18 5.12 accounting

Clone Sequence Records

IP11229.complete Sequence

1313 bp (1313 high quality bases) assembled on 2006-01-20

GenBank Submission: BT024318

> IP11229.complete
AAAACGCAACCAAAAACCCCAATAGCGCAAGATCAATACCAACTTTCACA
TAACACTGGTTGCCGTTCCTACCACTTCACTCCAGCAGAAGCCATCCACC
ATCAGCGCAAAAACCGGTGGTTGCGAGCGGCTCAAATAATAGGTGCGGTT
GCCGTTCCTACCACTTCACAGCAGAAGCCATCCACCATCAGCGCAAAAAC
CGGTGGTTGCGAGCGGCTCAAATAATAGGTGCGGTTGCCGTTCCTACCAC
TTCACTCCAGCAGAAGCCATCCACCATCGATATGTCATGCAAGAATTGCC
CTCCCTACAAGAACTCCGAATTGGGCATCTTCTTTCCGGATTGCTTCGAA
CGCGTCAGCGGTCATTGCAACAAGAAGAATCCCGGCAATGTCCAGAATCT
CCACATCCTGGCCCATCGGGTGATGCCCAAATTCTACGATGGCATCGAAC
TGGACTACCTCCACCGCCTGGCACCCAACAAATATATCACGGCCGCCTGG
GTTCTCAGTCACATCAGGCCATCGGGTTTTCGCTTCGGCGGACTATACAC
GTTTCGGGTTCAAGACGATACTATGTACACCCCAACCATTATGGGCGACA
TACATCCCACTTCACTCGCTGCCAACCTGAACATACTGTACTATCCTTTT
CAATCCCTTCGCATGGAGGCCGTGCTGCAGAAGGCCAGGGAGGCCGCGGT
GGAGAGCCAGTATACGATCGAGTGGACGAGGCCATGCGACACGTGGACCG
CCAACTTTTACAATGTGCGGAATGAAAGTGGACGTTGCACAATGTCCGTG
ATGAGATCGGTATCCGCACACTGGGCCCTCGGCGGGGAACTTCTACTGGA
GTGGAACGATCCCCAGAAACTGACTCCGGATCTGGCGCTCGCAGCACGTT
ACTCCCATTATAACTATTCCTTGGCTGCCACCGCATCGAGGCAGGGATTG
GATGTCACCTACTGGCAGCGCATTCATCCCCATATCCAGATGGCCAATCT
CTTGGCGTGGAATCGTAATACCCGAAAGACCATTGCCACGATATGCTATC
AATGGAACTTCTGGAACTCAGCCGTCCATGGGATGTTCGATTCGGATGCC
TCCGTGGGCTTCATGTGGACAAAATACCTGACGCATTTGCCACTGCAAAT
GGGTTTCAGTGTAGTGATGAATCTGCCCACAGATCGATTTGCTTTCGGCA
TGCGTTTTGTTTTGGACCCAAGTGGATTGAGACGTGGCGAGTAATTTTCT
GTATTGGTTTTACTACATGTGTACAACAAAATTATCAATTGCAAGTAAAA
AAAAAAAAAAAAA

IP11229.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:21:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG4520.a 1601 CG4520.a 188..1252 233..1297 5325 100 Plus
CG4520-RA 1171 CG4520-RA 86..1150 233..1297 5325 100 Plus
CG4520.b 1586 CG4520.b 188..1252 233..1297 5325 100 Plus
CG4520.a 1601 CG4520.a 131..233 1..103 515 100 Plus
CG4520-RA 1171 CG4520-RA 29..131 1..103 515 100 Plus
CG4520.b 1586 CG4520.b 131..233 1..103 515 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11569351..11569693 233..575 1670 99.1 Plus
chr3R 27901430 chr3R 11569783..11570106 575..898 1605 99.7 Plus
chr3R 27901430 chr3R 11570163..11570388 898..1123 1130 100 Plus
chr3R 27901430 chr3R 11570441..11570613 1124..1296 865 100 Plus
chr3R 27901430 chr3R 11569294..11569396 1..103 485 98.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:05:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15744739..15745081 233..575 1715 100 Plus
3R 32079331 3R 15745171..15745494 575..898 1620 100 Plus
3R 32079331 3R 15745551..15745776 898..1123 1130 100 Plus
3R 32079331 3R 15745829..15746002 1124..1297 870 100 Plus
3R 32079331 3R 15744682..15744784 1..103 515 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15485570..15485912 233..575 1715 100 Plus
3R 31820162 3R 15486002..15486325 575..898 1620 100 Plus
3R 31820162 3R 15486382..15486607 898..1123 1130 100 Plus
3R 31820162 3R 15486660..15486833 1124..1297 870 100 Plus
3R 31820162 3R 15485513..15485615 1..103 515 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:41:46 has no hits.

IP11229.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:42:31 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11569351..11569693 233..575 99 -> Plus
chr3R 11569784..11570106 576..898 99 -> Plus
chr3R 11570164..11570388 899..1123 100 == Plus
chr3R 11570477..11570613 1160..1296 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:48:38 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
CG4520-RA 1..963 282..1244 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:37:23 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
CG4520-RA 1..963 282..1244 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:51:49 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
CG4520-RA 1..963 282..1244 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:12:18 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
CG4520-RA 1..963 282..1244 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:10:30 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
CG4520-RA 1..963 282..1244 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:09:10 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
CG4520-RA 86..1149 233..1296 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:37:23 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
CG4520-RA 86..1149 233..1296 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:51:49 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
CG4520-RA 86..1149 233..1296 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:12:18 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
CG4520-RA 86..1149 233..1296 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:10:30 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
CG4520-RA 86..1149 233..1296 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:31 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15745552..15745776 899..1123 100 -> Plus
3R 15744739..15745081 233..575 100 -> Plus
3R 15745172..15745494 576..898 100 -> Plus
3R 15745829..15746001 1124..1296 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:31 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15745552..15745776 899..1123 100 -> Plus
3R 15744739..15745081 233..575 100 -> Plus
3R 15745172..15745494 576..898 100 -> Plus
3R 15745829..15746001 1124..1296 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:31 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15745552..15745776 899..1123 100 -> Plus
3R 15744739..15745081 233..575 100 -> Plus
3R 15745172..15745494 576..898 100 -> Plus
3R 15745829..15746001 1124..1296 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:51:49 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11570461..11570803 233..575 100 -> Plus
arm_3R 11570894..11571216 576..898 100 -> Plus
arm_3R 11571274..11571498 899..1123 100 -> Plus
arm_3R 11571551..11571723 1124..1296 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:00:36 Download gff for IP11229.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15485570..15485912 233..575 100 -> Plus
3R 15486003..15486325 576..898 100 -> Plus
3R 15486383..15486607 899..1123 100 -> Plus
3R 15486660..15486832 1124..1296 100   Plus

IP11229.hyp Sequence

Translation from 233 to 1243

> IP11229.hyp
VAVPTTSLQQKPSTIDMSCKNCPPYKNSELGIFFPDCFERVSGHCNKKNP
GNVQNLHILAHRVMPKFYDGIELDYLHRLAPNKYITAAWVLSHIRPSGFR
FGGLYTFRVQDDTMYTPTIMGDIHPTSLAANLNILYYPFQSLRMEAVLQK
AREAAVESQYTIEWTRPCDTWTANFYNVRNESGRCTMSVMRSVSAHWALG
GELLLEWNDPQKLTPDLALAARYSHYNYSLAATASRQGLDVTYWQRIHPH
IQMANLLAWNRNTRKTIATICYQWNFWNSAVHGMFDSDASVGFMWTKYLT
HLPLQMGFSVVMNLPTDRFAFGMRFVLDPSGLRRGE*

IP11229.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG4520-PB 320 CG4520-PB 1..320 17..336 1754 100 Plus
CG4520-PA 320 CG4520-PA 1..320 17..336 1754 100 Plus
Tom40-PC 344 CG12157-PC 58..338 48..322 204 24.8 Plus
Tom40-PB 344 CG12157-PB 58..338 48..322 204 24.8 Plus
Tom40-PA 344 CG12157-PA 58..338 48..322 204 24.8 Plus

IP11229.pep Sequence

Translation from 281 to 1243

> IP11229.pep
MSCKNCPPYKNSELGIFFPDCFERVSGHCNKKNPGNVQNLHILAHRVMPK
FYDGIELDYLHRLAPNKYITAAWVLSHIRPSGFRFGGLYTFRVQDDTMYT
PTIMGDIHPTSLAANLNILYYPFQSLRMEAVLQKAREAAVESQYTIEWTR
PCDTWTANFYNVRNESGRCTMSVMRSVSAHWALGGELLLEWNDPQKLTPD
LALAARYSHYNYSLAATASRQGLDVTYWQRIHPHIQMANLLAWNRNTRKT
IATICYQWNFWNSAVHGMFDSDASVGFMWTKYLTHLPLQMGFSVVMNLPT
DRFAFGMRFVLDPSGLRRGE*

IP11229.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18535-PA 320 GF18535-PA 1..320 1..320 1526 86.3 Plus
Dana\GF11050-PA 337 GF11050-PA 51..336 32..311 186 23.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16943-PA 322 GG16943-PA 3..322 2..320 1672 95.6 Plus
Dere\GG19657-PA 344 GG19657-PA 58..343 32..311 218 24.9 Plus
Dere\GG23200-PA 340 GG23200-PA 38..339 19..311 191 23.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18215-PA 317 GH18215-PA 1..317 1..320 1331 75.7 Plus
Dgri\GH12583-PA 344 GH12583-PA 59..343 33..311 190 23.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG4520-PB 320 CG4520-PB 1..320 1..320 1754 100 Plus
CG4520-PA 320 CG4520-PA 1..320 1..320 1754 100 Plus
Tom40-PC 344 CG12157-PC 58..338 32..306 204 24.8 Plus
Tom40-PB 344 CG12157-PB 58..338 32..306 204 24.8 Plus
Tom40-PA 344 CG12157-PA 58..338 32..306 204 24.8 Plus
tomboy40-PA 340 CG8330-PA 55..334 33..306 179 23.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10168-PA 317 GI10168-PA 1..317 1..320 1389 78.2 Plus
Dmoj\GI16206-PA 344 GI16206-PA 58..343 32..311 200 23.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12703-PA 321 GL12703-PA 1..319 1..318 1281 69.6 Plus
Dper\GL14724-PA 334 GL14724-PA 48..333 32..311 209 23.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18230-PA 321 GA18230-PA 1..319 1..318 1278 69.3 Plus
Dpse\GA11443-PA 334 GA11443-PA 48..333 32..311 207 23.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24251-PA 321 GM24251-PA 1..321 1..320 1718 98.1 Plus
Dsec\GM17536-PA 344 GM17536-PA 58..343 32..311 224 24.7 Plus
Dsec\GM16540-PA 340 GM16540-PA 55..339 33..311 183 23.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19040-PA 321 GD19040-PA 1..321 1..320 1718 98.1 Plus
Dsim\GD16856-PA 344 GD16856-PA 58..343 32..311 224 24.7 Plus
Dsim\GD10402-PA 340 GD10402-PA 55..339 33..311 183 23.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10870-PA 317 GJ10870-PA 1..317 1..320 1389 78.2 Plus
Dvir\GJ15896-PA 343 GJ15896-PA 57..342 32..311 200 23.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11414-PA 319 GK11414-PA 1..319 1..320 1386 76.3 Plus
Dwil\GK25006-PA 346 GK25006-PA 60..345 32..311 214 24.9 Plus
Dwil\GK19497-PA 341 GK19497-PA 55..340 32..311 173 23.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24330-PA 322 GE24330-PA 3..322 2..320 1690 96.6 Plus
Dyak\GE15731-PA 344 GE15731-PA 58..343 32..311 216 24.9 Plus
Dyak\GE20769-PA 340 GE20769-PA 49..339 27..311 189 23.3 Plus