Clone IP11239 Report

Search the DGRC for IP11239

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:112
Well:39
Vector:pOT2
Associated Gene/TranscriptCG5379-RA
Protein status:IP11239.pep: gold
Preliminary Size:969
Sequenced Size:1142

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5379 2005-01-01 Successful iPCR screen
CG5379 2008-04-29 Release 5.5 accounting
CG5379 2008-08-15 Release 5.9 accounting
CG5379 2008-12-18 5.12 accounting

Clone Sequence Records

IP11239.complete Sequence

1142 bp (1142 high quality bases) assembled on 2005-05-04

GenBank Submission: BT022927

> IP11239.complete
TGGAGCGTATTTGGACTAGATTGGCGAAGACAACTCCTATAGCCTGTAGT
AGTGTATAGCGAGTGATCAGGTGGAAAATGCATCTTCCGGCTCTTGATGA
CTTCTATCAGCGTCTTCTGTTTCTGCTGCCGTTCGCCGCAAATTTCAGAT
CGACTGATTTCGACTACAAATCCCCGGAGAGGTGGCCGGAAAAATACCCA
AATTGTGGTGGATCAGAACAGTCGCCCATTGCGATTAGCAGACGCAAGGC
GATACCCCTTAACTTGCCGCCTCTGATTTTCGCACTTTATGATGAGTTCT
TCGATGAGCTGGTGACAATTAGGAATAGTGGACACACAGTGGAATTTAAG
GTTCCGACGACGATCTATGGCGTGAAGCCCTACGTAACAGGAGGTCTCTT
GCGGGACTGCTACGATGCCGAGGCCGTGCATTTCCATTGGGGATCCCCCG
AGAGCAAGGGCTCGGAGCACCTGCTCAATGGACGCCGCTTTGATCTGGAA
ATGCACATAGTCCATCGGAACACAAAGTATTTAAACTTGGAGGAGGCTGT
TAAGTACAGCGATGGCGTTACAGTACTGGCGGTGCTCTTTAAGGTTGTTC
GATCGGGGCCATTCTTTTATCAGCCCGGACTCAGTGAAATCTTTAGTTCC
CTCCTCCATTTGGGCAACTTTAATGCCAGCTACACTGTGCAGGAACGGCT
CACCCTGGGATCCTTGCTGGGATCTCTTGACAGGGGAAACTTTTACACGT
ACAAGGGCTCCCTAACGACGCCACCATGCTCACCGGTGGTTCAGTGGCAC
GTGTTCGGTGAGGTCCTTCCCATTTCGCACCAGGATCTGCCCAAATTCTG
GAACCTCCGAGATGAGCGCGGTCGGCCGTTGCTAAAGAATTTCCGGCCAC
TACAATCGCAGGAGAATCGACTGATATTTCACCGTCAACATATAGTGCCG
CTGCAGCAGGAGCATCTCCAAGAACTGATATGGCTATAGCCATTAGATTA
AATCTAACACCCTCTATGTAAATGAATTCGAACACCCTTTATTTAGATTG
AATCTAACACCATTTATTTTTTAAAAAAGTAAAGTATTCTATATCATGCT
TCTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP11239.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG5379-RA 1155 CG5379-RA 52..1155 1..1104 5520 100 Plus
CG31169.a 4366 CG31169.a 4306..4366 1105..1045 305 100 Minus
CG31169-RA 4620 CG31169-RA 4560..4620 1105..1045 305 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18210035..18210536 1104..603 2510 100 Minus
chr3R 27901430 chr3R 18210605..18210869 602..338 1325 100 Minus
chr3R 27901430 chr3R 18210925..18211122 339..142 945 98.5 Minus
chr3R 27901430 chr3R 18211878..18212018 141..1 705 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:05:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22386488..22386990 1105..603 2515 100 Minus
3R 32079331 3R 22387059..22387323 602..338 1325 100 Minus
3R 32079331 3R 22387379..22387576 339..142 990 100 Minus
3R 32079331 3R 22388332..22388472 141..1 705 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22127319..22127821 1105..603 2515 100 Minus
3R 31820162 3R 22127890..22128154 602..338 1325 100 Minus
3R 31820162 3R 22128210..22128407 339..142 990 100 Minus
3R 31820162 3R 22129163..22129303 141..1 705 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:28:48 has no hits.

IP11239.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:29:47 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18210035..18210536 603..1104 100 <- Minus
chr3R 18210605..18210867 340..602 100 <- Minus
chr3R 18210925..18211122 142..339 98 <- Minus
chr3R 18211878..18212018 1..141 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:48:42 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
CG5379-RA 1..912 78..989 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:42:36 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
CG5379-RA 1..912 78..989 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:00:16 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
CG5379-RA 1..912 78..989 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:22:13 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
CG5379-RA 1..912 78..989 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:21:24 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
CG5379-RA 1..912 78..989 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:15:31 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
CG5379-RA 1..1104 1..1104 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:42:36 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
CG5379-RA 1..1104 1..1104 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:00:16 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
CG5379-RA 12..1115 1..1104 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:22:14 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
CG5379-RA 1..1104 1..1104 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:21:24 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
CG5379-RA 12..1115 1..1104 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:47 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22386489..22386990 603..1104 100 <- Minus
3R 22387059..22387321 340..602 100 <- Minus
3R 22387379..22387576 142..339 100 <- Minus
3R 22388332..22388472 1..141 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:47 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22386489..22386990 603..1104 100 <- Minus
3R 22387059..22387321 340..602 100 <- Minus
3R 22387379..22387576 142..339 100 <- Minus
3R 22388332..22388472 1..141 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:29:47 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22386489..22386990 603..1104 100 <- Minus
3R 22387059..22387321 340..602 100 <- Minus
3R 22387379..22387576 142..339 100 <- Minus
3R 22388332..22388472 1..141 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:00:16 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18213101..18213298 142..339 100 <- Minus
arm_3R 18214054..18214194 1..141 100   Minus
arm_3R 18212781..18213043 340..602 100 <- Minus
arm_3R 18212211..18212712 603..1104 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:04:22 Download gff for IP11239.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22127320..22127821 603..1104 100 <- Minus
3R 22127890..22128152 340..602 100 <- Minus
3R 22128210..22128407 142..339 100 <- Minus
3R 22129163..22129303 1..141 100   Minus

IP11239.hyp Sequence

Translation from 77 to 988

> IP11239.hyp
MHLPALDDFYQRLLFLLPFAANFRSTDFDYKSPERWPEKYPNCGGSEQSP
IAISRRKAIPLNLPPLIFALYDEFFDELVTIRNSGHTVEFKVPTTIYGVK
PYVTGGLLRDCYDAEAVHFHWGSPESKGSEHLLNGRRFDLEMHIVHRNTK
YLNLEEAVKYSDGVTVLAVLFKVVRSGPFFYQPGLSEIFSSLLHLGNFNA
SYTVQERLTLGSLLGSLDRGNFYTYKGSLTTPPCSPVVQWHVFGEVLPIS
HQDLPKFWNLRDERGRPLLKNFRPLQSQENRLIFHRQHIVPLQQEHLQEL
IWL*

IP11239.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG5379-PB 303 CG5379-PB 1..303 1..303 1628 100 Plus
CG5379-PA 303 CG5379-PA 1..303 1..303 1628 100 Plus
CG3669-PB 298 CG3669-PB 6..286 10..286 622 43 Plus
CG18673-PC 302 CG18673-PC 42..299 29..286 534 41.5 Plus
CG18672-PC 286 CG18672-PC 6..285 10..289 518 38.7 Plus

IP11239.pep Sequence

Translation from 77 to 988

> IP11239.pep
MHLPALDDFYQRLLFLLPFAANFRSTDFDYKSPERWPEKYPNCGGSEQSP
IAISRRKAIPLNLPPLIFALYDEFFDELVTIRNSGHTVEFKVPTTIYGVK
PYVTGGLLRDCYDAEAVHFHWGSPESKGSEHLLNGRRFDLEMHIVHRNTK
YLNLEEAVKYSDGVTVLAVLFKVVRSGPFFYQPGLSEIFSSLLHLGNFNA
SYTVQERLTLGSLLGSLDRGNFYTYKGSLTTPPCSPVVQWHVFGEVLPIS
HQDLPKFWNLRDERGRPLLKNFRPLQSQENRLIFHRQHIVPLQQEHLQEL
IWL*

IP11239.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16571-PA 314 GF16571-PA 1..314 1..303 1071 65.3 Plus
Dana\GF17777-PA 247 GF17777-PA 10..232 63..286 551 46.4 Plus
Dana\GF17778-PA 303 GF17778-PA 42..299 29..286 530 40.4 Plus
Dana\GF22952-PA 311 GF22952-PA 6..286 9..286 460 35.1 Plus
Dana\GF18008-PA 287 GF18008-PA 21..274 28..284 426 35.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:33:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12522-PA 303 GG12522-PA 1..303 1..303 1499 90.8 Plus
Dere\GG11800-PA 630 GG11800-PA 370..627 29..286 535 41.5 Plus
Dere\GG12140-PA 311 GG12140-PA 3..286 6..286 476 35.8 Plus
Dere\GG12312-PA 279 GG12312-PA 21..274 28..284 392 34 Plus
Dere\GG11800-PA 630 GG11800-PA 134..349 57..273 366 36.9 Plus
Dere\GG11800-PA 630 GG11800-PA 22..144 63..189 338 48.8 Plus
Dere\GG17412-PA 304 GG17412-PA 26..269 27..283 323 32.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17509-PA 297 GH17509-PA 1..292 1..290 1071 69.2 Plus
Dgri\GH18011-PA 245 GH18011-PA 2..240 47..286 593 47.1 Plus
Dgri\GH18014-PA 331 GH18014-PA 55..331 10..289 511 40.2 Plus
Dgri\GH18013-PA 286 GH18013-PA 43..286 45..289 499 40 Plus
Dgri\GH22268-PA 258 GH22268-PA 23..258 53..289 490 40.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG5379-PB 303 CG5379-PB 1..303 1..303 1628 100 Plus
CG5379-PA 303 CG5379-PA 1..303 1..303 1628 100 Plus
CG3669-PB 298 CG3669-PB 6..286 10..286 622 43 Plus
CG18673-PC 302 CG18673-PC 42..299 29..286 534 41.5 Plus
CG18672-PC 286 CG18672-PC 6..285 10..289 518 38.7 Plus
CG18672-PD 281 CG18672-PD 6..280 10..289 511 38.4 Plus
CG18672-PB 284 CG18672-PB 6..283 10..289 505 38 Plus
caix-PA 311 CG6074-PA 3..286 6..286 457 36.1 Plus
CG10899-PA 279 CG10899-PA 35..274 45..284 395 35.4 Plus
CAH2-PA 335 CG6906-PA 27..291 27..292 330 33.3 Plus
CG10899-PC 200 CG10899-PC 2..195 91..284 329 35 Plus
CG3940-PC 304 CG3940-PC 26..269 27..283 318 31.8 Plus
CG3940-PB 304 CG3940-PB 26..269 27..283 318 31.8 Plus
CG3940-PA 304 CG3940-PA 26..269 27..283 318 31.8 Plus
CAH1-PA 270 CG7820-PA 13..255 33..274 286 33.9 Plus
CAH2-PB 253 CG6906-PB 3..209 83..292 254 32.7 Plus
CG12309-PA 527 CG12309-PA 53..371 6..301 238 25.7 Plus
CG11284-PE 250 CG11284-PE 4..230 48..276 223 28.6 Plus
CG11284-PD 250 CG11284-PD 4..230 48..276 223 28.6 Plus
CG11284-PC 250 CG11284-PC 4..230 48..276 223 28.6 Plus
CG11284-PB 250 CG11284-PB 4..230 48..276 223 28.6 Plus
CG11284-PA 250 CG11284-PA 4..230 48..276 223 28.6 Plus
CG9235-PA 332 CG9235-PA 81..324 25..284 222 28.8 Plus
CG32698-PD 327 CG32698-PD 54..293 45..283 162 25.9 Plus
CG32698-PB 327 CG32698-PB 54..293 45..283 162 25.9 Plus
CG32698-PC 327 CG32698-PC 54..293 45..283 162 25.9 Plus
CG32698-PA 327 CG32698-PA 54..293 45..283 162 25.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10376-PA 298 GI10376-PA 1..289 1..287 1051 68.5 Plus
Dmoj\GI23611-PA 207 GI23611-PA 1..198 90..288 518 49.7 Plus
Dmoj\GI23614-PA 278 GI23614-PA 27..273 44..291 515 39.5 Plus
Dmoj\GI23612-PA 410 GI23612-PA 65..302 45..281 476 40.2 Plus
Dmoj\GI23275-PA 310 GI23275-PA 24..285 28..286 473 38.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23343-PA 301 GL23343-PA 1..201 1..199 733 67.7 Plus
Dper\GL13738-PA 234 GL13738-PA 1..223 63..286 542 44.2 Plus
Dper\GL26017-PA 288 GL26017-PA 53..278 45..269 491 43.6 Plus
Dper\GL13739-PA 353 GL13739-PA 63..295 45..276 458 40 Plus
Dper\GL23614-PA 305 GL23614-PA 6..280 9..286 436 34.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18835-PA 297 GA18835-PA 1..289 1..287 1084 70.2 Plus
Dpse\GA27011-PB 304 GA27011-PB 53..293 45..286 569 43.4 Plus
Dpse\GA25239-PA 298 GA25239-PA 53..293 45..284 520 43 Plus
Dpse\GA27012-PA 314 GA27012-PA 63..306 45..287 489 40.7 Plus
Dpse\GA19339-PA 311 GA19339-PA 6..286 9..286 476 35.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23657-PA 314 GM23657-PA 1..270 1..270 1351 95.9 Plus
Dsec\GM12931-PA 299 GM12931-PA 47..287 45..286 589 45 Plus
Dsec\GM12933-PA 302 GM12933-PA 42..299 29..286 530 41.2 Plus
Dsec\GM12932-PA 266 GM12932-PA 19..259 45..286 499 40.1 Plus
Dsec\GM10133-PA 311 GM10133-PA 3..286 6..286 471 35.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18465-PA 303 GD18465-PA 1..303 1..303 1586 97.7 Plus
Dsim\GD21568-PA 299 GD21568-PA 47..287 45..286 597 45.5 Plus
Dsim\GD21570-PA 260 GD21570-PA 17..257 45..286 530 42.8 Plus
Dsim\GD18095-PA 311 GD18095-PA 3..286 6..286 471 35.8 Plus
Dsim\GD21569-PA 238 GD21569-PA 33..231 87..286 441 41 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22838-PA 297 GJ22838-PA 1..289 1..287 1034 67.8 Plus
Dvir\GJ23584-PA 246 GJ23584-PA 13..235 63..286 562 46.9 Plus
Dvir\GJ23586-PA 272 GJ23586-PA 27..268 44..286 522 42.4 Plus
Dvir\GJ23585-PA 304 GJ23585-PA 59..301 45..286 505 41.5 Plus
Dvir\GJ24133-PA 310 GJ24133-PA 1..285 1..286 471 36.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:33:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12982-PA 297 GK12982-PA 1..288 1..286 1021 68.4 Plus
Dwil\GK10872-PA 306 GK10872-PA 59..301 45..286 518 40.3 Plus
Dwil\GK10871-PA 205 GK10871-PA 3..199 92..289 515 48 Plus
Dwil\GK12035-PA 312 GK12035-PA 26..287 28..286 487 38.7 Plus
Dwil\GK13282-PA 300 GK13282-PA 11..277 25..291 326 34.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24045-PA 162 GE24045-PA 1..162 142..303 752 93.2 Plus
Dyak\GE10928-PA 298 GE10928-PA 17..286 23..286 595 42.1 Plus
Dyak\GE10930-PA 302 GE10930-PA 42..299 29..286 534 40.8 Plus
Dyak\GE10587-PA 311 GE10587-PA 6..286 9..286 476 36.1 Plus
Dyak\GE24044-PA 94 GE24044-PA 1..92 1..92 429 84.8 Plus