Clone IP11306 Report

Search the DGRC for IP11306

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:113
Well:6
Vector:pOT2
Associated Gene/TranscriptCG32568-RB
Protein status:IP11306.pep: gold
Preliminary Size:1037
Sequenced Size:1539

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32568 2005-01-01 Successful iPCR screen
CG32568 2008-04-29 Release 5.5 accounting
CG32568 2008-08-15 Release 5.9 accounting
CG32568 2008-12-18 5.12 accounting

Clone Sequence Records

IP11306.complete Sequence

1539 bp (1539 high quality bases) assembled on 2005-05-04

GenBank Submission: BT022344

> IP11306.complete
ATTAACGAACACATATTCCGCTTCTCGAAAAAAAAAAATTCCCAAAAATT
TTTTTTATATTTTAAACAATCCTAAAATGAATAACTCCAAACGCTCGCGA
CTCAGCGACAAGGATGAAGGTCCGTGCAAAATTCGAAAAGCGACCAACCT
GTCGGATAAGAAGGCAATCGTAGATCTATTCTCTAGTTTCGTGAATACAC
ATCATTTTCGACCCAACCCCGATGGTCAGAGGATTGATAAAATAATTGTA
ATAAAGTTAGTGGAACGCTTAGAAACTACAGATGTAAATGATCGCAAATT
TATGCAGAGTATATTGCGGCGCGTCTATTTAAAGTGCACCGACTTGCGTC
TATTTATTCGAAATCAGCTCAACGATGTATTCTTTCGATTGATTTTCGAA
GGAACTGACTTTCATTGCATCCCAGAAATTCTGGAAATTTACTATGATAT
AATCAAGGGATTTACTCAACCATATGAGACTGAACATGAGCAACTGCTCT
TTAAGATCCTTTTGCCTTTGCACAAGCCGCCATCGTTAACAAAGTATTTT
CATCAGCTGATAAAATGCATTATTGCATTCCTTAACCAATATCCATCTTT
CATTGAAAAATATGTCAAAGGTCTTCTACGGCTCTGGCCGAAGACGTCCT
TTACTAAGGTGACATTGTTTCTAAGCGAGATTGCCAGAATTTTGGTAATA
AAAAATGAGCAAGAGGTCAAGAAAGTCATGCTGACGATTTTTAATCATAT
TGCAAAATGTCTGTGTGATGAAAGCAATAAGATAGCCGAGCACACTCTTC
TTTTGTGGAAAAACAATGCGGTTTTGGAGGTTATACATCGAAACCACGCG
CTCATCATGCCCATTGTATATCCACACGTATTACGCGTATTGATACGTCA
TTATATGAGAAAACCAATGCAAACGAATGCCTCCATTGCTTTATGTACTT
TACTAAAAATGAACAATCCGATGCTTAGATGCCTGACTACTGTATGCATG
AGCACCGATCATAGACCGATGAAACACGACGCCGAGAATTCTATACCTAA
GTAGATTATATAAGAACTACATTAATGATAACAACAGAAACATTGCATAT
TTATTTTATATGTCAATATTTCTTAACACTTCATACTTTACAAACCATAA
AGAACTTTTAGCACAATCGAAATATATCTGCAAGCGGGCTAATCTTTTCA
ATGCTGATCAAATTAAGACATAAACACGTTCCTGCATATACATGATCAAT
CGCCAAAAATTAATCAATTAATCGAGGATTTTATACGGACTTTTGCATAC
AACTTAAAAATGGTGGCTTGATAATTATCACAAAACAATATGACAAAACG
GAAAAAATGCAACCGAATTTCGTGCGTTGTGTATTCGTGGTGGAATTGAA
AACGATATTTTGATAGTGATGCTGATATGGATATTGATATTGATCCACCT
GCGATCAACAACGTCGACGACCGGCAAATATATATGAACTCGACTATGAT
TTATGATCGCACCGAATAAAAAAAAAAAAAAAAAAAAAA

IP11306.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG32568-RB 1539 CG32568-RB 23..1539 1..1517 7585 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16631567..16632304 780..1517 3675 99.9 Plus
chrX 22417052 chrX 16631189..16631522 448..781 1670 100 Plus
chrX 22417052 chrX 16630591..16630847 1..256 1205 98.8 Plus
chrX 22417052 chrX 16630901..16631093 255..447 965 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:06:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16741902..16742660 780..1538 3780 99.9 Plus
X 23542271 X 16741524..16741857 448..781 1670 100 Plus
X 23542271 X 16740928..16741183 1..256 1280 100 Plus
X 23542271 X 16741237..16741429 255..447 965 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16750000..16750758 780..1538 3780 99.8 Plus
X 23527363 X 16749622..16749955 448..781 1670 100 Plus
X 23527363 X 16749026..16749281 1..256 1280 100 Plus
X 23527363 X 16749335..16749527 255..447 965 100 Plus
Blast to na_te.dros performed on 2019-03-15 12:03:06 has no hits.

IP11306.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:04:08 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16630591..16630847 1..256 98 -> Plus
chrX 16630903..16631093 257..447 100 -> Plus
chrX 16631189..16631522 448..781 100 -> Plus
chrX 16631569..16632304 782..1517 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:49:03 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
CG32568-RA 1..969 77..1054 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:42:29 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
CG32568-RB 1..978 77..1054 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:36:41 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
CG32568-RB 1..978 77..1054 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:21:55 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
CG32568-RA 1..969 77..1054 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:50:29 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
CG32568-RB 1..978 77..1054 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:15:22 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
CG32568-RA 1..1037 9..1054 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:42:29 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
CG32568-RB 23..1539 1..1517 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:36:41 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
CG32568-RB 23..1539 1..1517 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:21:56 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
CG32568-RA 1..1037 9..1054 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:50:29 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
CG32568-RB 23..1539 1..1517 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:04:08 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
X 16740928..16741183 1..256 100 -> Plus
X 16741239..16741429 257..447 100 -> Plus
X 16741524..16741857 448..781 100 -> Plus
X 16741904..16742639 782..1517 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:04:08 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
X 16740928..16741183 1..256 100 -> Plus
X 16741239..16741429 257..447 100 -> Plus
X 16741524..16741857 448..781 100 -> Plus
X 16741904..16742639 782..1517 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:04:08 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
X 16740928..16741183 1..256 100 -> Plus
X 16741239..16741429 257..447 100 -> Plus
X 16741524..16741857 448..781 100 -> Plus
X 16741904..16742639 782..1517 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:36:41 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16634961..16635216 1..256 100 -> Plus
arm_X 16635272..16635462 257..447 100 -> Plus
arm_X 16635557..16635890 448..781 100 -> Plus
arm_X 16635937..16636672 782..1517 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:04:16 Download gff for IP11306.complete
Subject Subject Range Query Range Percent Splice Strand
X 16749026..16749281 1..256 100 -> Plus
X 16749337..16749527 257..447 100 -> Plus
X 16749622..16749955 448..781 100 -> Plus
X 16750002..16750737 782..1517 100   Plus

IP11306.hyp Sequence

Translation from 0 to 1053

> IP11306.hyp
LTNTYSASRKKKIPKNFFYILNNPKMNNSKRSRLSDKDEGPCKIRKATNL
SDKKAIVDLFSSFVNTHHFRPNPDGQRIDKIIVIKLVERLETTDVNDRKF
MQSILRRVYLKCTDLRLFIRNQLNDVFFRLIFEGTDFHCIPEILEIYYDI
IKGFTQPYETEHEQLLFKILLPLHKPPSLTKYFHQLIKCIIAFLNQYPSF
IEKYVKGLLRLWPKTSFTKVTLFLSEIARILVIKNEQEVKKVMLTIFNHI
AKCLCDESNKIAEHTLLLWKNNAVLEVIHRNHALIMPIVYPHVLRVLIRH
YMRKPMQTNASIALCTLLKMNNPMLRCLTTVCMSTDHRPMKHDAENSIPK
*

IP11306.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG32568-PC 325 CG32568-PC 1..325 26..350 1706 100 Plus
CG32568-PB 325 CG32568-PB 1..325 26..350 1706 100 Plus
wdb-PF 524 CG5643-PF 149..437 56..345 488 34.8 Plus
wdb-PE 524 CG5643-PE 149..437 56..345 488 34.8 Plus
wdb-PC 524 CG5643-PC 149..437 56..345 488 34.8 Plus

IP11306.pep Sequence

Translation from 1 to 1053

> IP11306.pep
LTNTYSASRKKKIPKNFFYILNNPKMNNSKRSRLSDKDEGPCKIRKATNL
SDKKAIVDLFSSFVNTHHFRPNPDGQRIDKIIVIKLVERLETTDVNDRKF
MQSILRRVYLKCTDLRLFIRNQLNDVFFRLIFEGTDFHCIPEILEIYYDI
IKGFTQPYETEHEQLLFKILLPLHKPPSLTKYFHQLIKCIIAFLNQYPSF
IEKYVKGLLRLWPKTSFTKVTLFLSEIARILVIKNEQEVKKVMLTIFNHI
AKCLCDESNKIAEHTLLLWKNNAVLEVIHRNHALIMPIVYPHVLRVLIRH
YMRKPMQTNASIALCTLLKMNNPMLRCLTTVCMSTDHRPMKHDAENSIPK
*

IP11306.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18705-PA 859 GF18705-PA 486..759 56..330 495 36.7 Plus
Dana\GF16761-PA 968 GF16761-PA 553..798 56..301 493 39 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19075-PA 310 GG19075-PA 1..302 26..330 741 49.7 Plus
Dere\GG12108-PA 524 GG12108-PA 149..422 56..330 493 36.4 Plus
Dere\GG22681-PA 701 GG22681-PA 292..537 56..301 487 38.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21692-PA 538 GH21692-PA 149..422 56..330 487 35.6 Plus
Dgri\GH15123-PA 990 GH15123-PA 579..824 56..301 474 37.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG32568-PC 325 CG32568-PC 1..325 26..350 1706 100 Plus
CG32568-PB 325 CG32568-PB 1..325 26..350 1706 100 Plus
wdb-PF 524 CG5643-PF 149..437 56..345 488 34.8 Plus
wdb-PE 524 CG5643-PE 149..437 56..345 488 34.8 Plus
wdb-PC 524 CG5643-PC 149..437 56..345 488 34.8 Plus
wdb-PA 524 CG5643-PA 149..437 56..345 488 34.8 Plus
wdb-PD 524 CG5643-PD 149..437 56..345 488 34.8 Plus
wdb-PB 524 CG5643-PB 149..437 56..345 488 34.8 Plus
wrd-PI 438 CG7913-PI 62..307 56..301 482 38.6 Plus
wrd-PC 554 CG7913-PC 178..423 56..301 482 38.6 Plus
wrd-PO 656 CG7913-PO 294..539 56..301 482 38.6 Plus
wrd-PK 656 CG7913-PK 294..539 56..301 482 38.6 Plus
wrd-PN 670 CG7913-PN 294..539 56..301 482 38.6 Plus
wrd-PM 670 CG7913-PM 294..539 56..301 482 38.6 Plus
wrd-PL 670 CG7913-PL 294..539 56..301 482 38.6 Plus
wrd-PD 670 CG7913-PD 294..539 56..301 482 38.6 Plus
wrd-PE 670 CG7913-PE 294..539 56..301 482 38.6 Plus
wrd-PP 683 CG7913-PP 307..552 56..301 482 38.6 Plus
wrd-PJ 703 CG7913-PJ 294..539 56..301 482 38.6 Plus
wrd-PQ 716 CG7913-PQ 307..552 56..301 482 38.6 Plus
wrd-PA 951 CG7913-PA 575..820 56..301 482 38.6 Plus
wrd-PB 984 CG7913-PB 575..820 56..301 482 38.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23720-PA 972 GI23720-PA 558..803 56..301 488 38.6 Plus
Dmoj\GI10753-PA 707 GI10753-PA 334..607 56..330 485 35.6 Plus
Dmoj\GI15981-PA 471 GI15981-PA 142..436 54..348 366 29.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23581-PA 534 GL23581-PA 150..423 56..330 493 36.4 Plus
Dper\GL12593-PA 761 GL12593-PA 346..591 56..301 493 39 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30019-PB 959 GA30019-PB 578..823 56..301 495 39 Plus
Dpse\GA26642-PA 536 GA26642-PA 150..423 56..330 493 36.4 Plus
Dpse\GA30019-PA 680 GA30019-PA 299..544 56..301 493 39 Plus
Dpse\GA30019-PC 714 GA30019-PC 299..544 56..301 492 39 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20543-PA 326 GM20543-PA 1..308 26..333 1121 70.2 Plus
Dsec\GM16338-PA 512 GM16338-PA 149..410 56..330 438 34.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17304-PA 323 GD17304-PA 1..317 26..348 1121 68.5 Plus
Dsim\GD18073-PA 676 GD18073-PA 346..574 56..330 336 29.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10695-PA 537 GJ10695-PA 149..422 56..330 489 36 Plus
Dvir\GJ23278-PA 506 GJ23278-PA 133..378 56..301 479 38.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11331-PA 526 GK11331-PA 149..422 56..330 495 36.4 Plus
Dwil\GK11246-PA 984 GK11246-PA 560..805 56..301 486 39 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17620-PA 260 GE17620-PA 1..243 86..329 624 50.8 Plus
Dyak\GE10557-PA 524 GE10557-PA 149..422 56..330 493 36.4 Plus
Dyak\GE25516-PA 832 GE25516-PA 292..537 56..301 492 39 Plus
Dyak\GE25516-PA 832 GE25516-PA 574..668 207..301 179 35.8 Plus