Clone IP11341 Report

Search the DGRC for IP11341

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:113
Well:41
Vector:pOT2
Associated Gene/TranscriptCG5611-RA
Protein status:IP11341.pep: gold
Preliminary Size:981
Sequenced Size:1130

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5611 2005-01-01 Successful iPCR screen
CG5611 2008-04-29 Release 5.5 accounting
CG5611 2008-08-15 Release 5.9 accounting
CG5611 2008-12-18 5.12 accounting

Clone Sequence Records

IP11341.complete Sequence

1130 bp (1130 high quality bases) assembled on 2006-06-13

GenBank Submission: BT028791

> IP11341.complete
GGGTTGTTGTTTCGAGCGTCGTAATGAGCAGATTTGTTTATAAACTTTTA
CAGAGTGCAAACCAAACTAGTTCGGGCTGCAGACGCATTTCTTTGGCTAC
TGTAAGAAATGCGGAAAGCGAATCTCAAGAGGGTGCCCCTGCCCGCACAG
TTCTGGTGGAGAAGGACTCGCACATAACACTTATTGGCCTAAATCGCGAG
CAGCAGCGTAATTCCATTGATGCCAACACCGCGGAGCAGCTGACCGAAGC
CATTAGCCAATTCGAAGCGGATGATACTTCTCCAGTGGGTGTGCTCTACG
GCATAGGTGGCTCCTTTTGTGCAGGCTATGATCTGGAGGAGCTAGAGGCG
GAGGCGCAACGCGGCAGCCTCAACTTTCTGTTGCGTCACGAGGGCTCCGT
CGGACCAACTAGGCGGCATCTCCGCAAGCCACTTGTTTGCGGCATCAGCG
GTTTCTGTGTGGCCGGTGGATTGGAACTGGCTCTAATGTGCGATCTCCGG
GTGATGGAGGACACTGCAGTTCTGGGGTTCTTCAACCGTCGCCTTGGAGT
TCCCCTGAGCGATGGTGGAACTGTGCGGCTGGCCGCTGCAGTGGGTTACT
CCAATGCCTTGGAGATCATCGCAACTGGAAGACGCATCTACTCTGGGGAG
GCGCGGCGAATCGGTTTAGTGAATCGCGTTGTGGCCACAGGCACAGCTTT
AGGTCAAGCTGTTAATCTGGCCTTTTCCATTGCCAAGTTCCCCATGGCTT
CCCTAATGCACGACAGGAATGCTGTGCTTGAAAATGCCAATGCCTACAAC
AAACCAGGATTCCATGTGGCCAGTTACAATGAGATCATGAATGTTACCTC
AGATATGATAACAGATATGCAGGAGGGCGTGAAGCGTTTCAAGAACTCTG
AAATAAAGGGCCCCAAAACCGATTCGTGGAGCATAAAGGAGAAAACCATT
CCAGATTGGGAAAAGGCCGAAATCGAGATCGAAAAACAAAAGCAAAAGAC
ATGACATATGTAGTTAGCTGATATATACAAAACTTCTGTTCTTCTGGTTA
GTTGCAATACTTTGTTGTTATATATAAAACGAAAGCCTTTATTCACGTAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP11341.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG5611-RA 1400 CG5611-RA 29..1128 3..1102 5500 100 Plus
CG5611.a 1388 CG5611.a 70..1116 56..1102 5235 100 Plus
CG5844.a 1335 CG5844.a 528..606 472..550 200 83.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23458071..23458969 901..3 4420 99.4 Minus
chr3R 27901430 chr3R 23457813..23458013 1098..898 1005 100 Minus
chr3R 27901430 chr3R 8260171..8260249 472..550 200 83.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:07:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27635162..27636060 901..3 4480 99.9 Minus
3R 32079331 3R 27634900..27635104 1102..898 1025 100 Minus
3R 32079331 3R 12434783..12434861 472..550 200 83.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27375993..27376891 901..3 4480 99.8 Minus
3R 31820162 3R 27375731..27375935 1102..898 1025 100 Minus
3R 31820162 3R 12175614..12175692 472..550 200 83.5 Plus
Blast to na_te.dros performed on 2019-03-16 02:09:48 has no hits.

IP11341.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:10:49 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23457813..23458013 898..1098 100 <- Minus
chr3R 23458075..23458969 1..897 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:49:12 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5611-RA 1..981 24..1004 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:21:31 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5611-RA 1..981 24..1004 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:11:28 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5611-RA 1..981 24..1004 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:39:58 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5611-RA 1..981 24..1004 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:59:02 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5611-RA 1..981 24..1004 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:50:04 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5611-RA 1..1096 3..1098 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:21:31 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5611-RA 1..1096 3..1098 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:11:28 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5611-RA 1..1096 3..1098 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:39:59 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5611-RA 1..981 24..1004 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:59:02 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
CG5611-RA 1..1096 3..1098 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:10:49 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27634904..27635104 898..1098 100 <- Minus
3R 27635166..27636060 1..897 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:10:49 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27634904..27635104 898..1098 100 <- Minus
3R 27635166..27636060 1..897 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:10:49 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27634904..27635104 898..1098 100 <- Minus
3R 27635166..27636060 1..897 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:11:28 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23460626..23460826 898..1098 100 <- Minus
arm_3R 23460888..23461782 1..897 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:50:13 Download gff for IP11341.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27375735..27375935 898..1098 100 <- Minus
3R 27375997..27376891 1..897 99   Minus

IP11341.hyp Sequence

Translation from 2 to 1003

> IP11341.hyp
VVVSSVVMSRFVYKLLQSANQTSSGCRRISLATVRNAESESQEGAPARTV
LVEKDSHITLIGLNREQQRNSIDANTAEQLTEAISQFEADDTSPVGVLYG
IGGSFCAGYDLEELEAEAQRGSLNFLLRHEGSVGPTRRHLRKPLVCGISG
FCVAGGLELALMCDLRVMEDTAVLGFFNRRLGVPLSDGGTVRLAAAVGYS
NALEIIATGRRIYSGEARRIGLVNRVVATGTALGQAVNLAFSIAKFPMAS
LMHDRNAVLENANAYNKPGFHVASYNEIMNVTSDMITDMQEGVKRFKNSE
IKGPKTDSWSIKEKTIPDWEKAEIEIEKQKQKT*

IP11341.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG5611-PC 326 CG5611-PC 1..326 8..333 1651 100 Plus
CG5611-PA 326 CG5611-PA 1..326 8..333 1651 100 Plus
CG5844-PA 378 CG5844-PA 34..330 35..332 832 54.3 Plus
CG6543-PA 295 CG6543-PA 18..234 24..243 252 31.5 Plus
CG6543-PB 295 CG6543-PB 18..234 24..243 252 31.5 Plus

IP11341.pep Sequence

Translation from 23 to 1003

> IP11341.pep
MSRFVYKLLQSANQTSSGCRRISLATVRNAESESQEGAPARTVLVEKDSH
ITLIGLNREQQRNSIDANTAEQLTEAISQFEADDTSPVGVLYGIGGSFCA
GYDLEELEAEAQRGSLNFLLRHEGSVGPTRRHLRKPLVCGISGFCVAGGL
ELALMCDLRVMEDTAVLGFFNRRLGVPLSDGGTVRLAAAVGYSNALEIIA
TGRRIYSGEARRIGLVNRVVATGTALGQAVNLAFSIAKFPMASLMHDRNA
VLENANAYNKPGFHVASYNEIMNVTSDMITDMQEGVKRFKNSEIKGPKTD
SWSIKEKTIPDWEKAEIEIEKQKQKT*

IP11341.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18700-PA 353 GF18700-PA 35..353 6..326 1359 81.6 Plus
Dana\GF17958-PA 375 GF17958-PA 33..332 28..325 869 54.5 Plus
Dana\GF11465-PA 299 GF11465-PA 37..266 43..259 226 31.8 Plus
Dana\GF11161-PA 293 GF11161-PA 40..232 41..236 214 30.8 Plus
Dana\GF21951-PA 1092 GF21951-PA 386..546 63..220 155 30.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12104-PA 329 GG12104-PA 1..326 1..326 1647 93.3 Plus
Dere\GG18938-PA 378 GG18938-PA 31..321 25..317 868 54.1 Plus
Dere\GG22466-PA 294 GG22466-PA 15..233 8..236 234 30.7 Plus
Dere\GG22562-PA 299 GG22562-PA 37..266 43..259 225 31.8 Plus
Dere\GG24022-PA 783 GG24022-PA 73..233 63..220 165 32.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21648-PA 328 GH21648-PA 5..325 4..326 1285 74.4 Plus
Dgri\GH21207-PA 382 GH21207-PA 37..315 29..309 860 56.4 Plus
Dgri\GH22640-PA 298 GH22640-PA 4..265 1..259 227 29.5 Plus
Dgri\GH20865-PA 293 GH20865-PA 40..232 41..236 217 30.3 Plus
Dgri\GH11058-PA 785 GH11058-PA 75..235 63..220 171 33.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG5611-PC 326 CG5611-PC 1..326 1..326 1651 100 Plus
CG5611-PA 326 CG5611-PA 1..326 1..326 1651 100 Plus
CG5844-PA 378 CG5844-PA 34..330 28..325 832 54.3 Plus
Echs1-PA 295 CG6543-PA 18..234 17..236 252 31.5 Plus
Echs1-PB 295 CG6543-PB 18..234 17..236 252 31.5 Plus
CG8778-PA 299 CG8778-PA 19..266 24..259 237 31.2 Plus
Mtpalpha-PB 744 CG4389-PB 34..194 63..220 190 34 Plus
Mtpalpha-PA 783 CG4389-PA 73..233 63..220 190 34 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10748-PA 324 GI10748-PA 5..323 4..325 1323 75.5 Plus
Dmoj\GI10483-PA 386 GI10483-PA 35..336 26..325 869 52.9 Plus
Dmoj\GI21154-PA 301 GI21154-PA 39..268 43..259 231 32.2 Plus
Dmoj\GI20973-PA 293 GI20973-PA 40..232 41..236 215 30.3 Plus
Dmoj\GI17575-PA 791 GI17575-PA 81..241 63..220 166 34 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13773-PA 302 GL13773-PA 9..302 33..326 1375 86.1 Plus
Dper\GL27313-PA 313 GL27313-PA 11..251 71..313 739 55.7 Plus
Dper\GL16995-PA 296 GL16995-PA 73..235 71..236 210 34.5 Plus
Dper\GL19219-PA 787 GL19219-PA 77..237 63..220 161 31.7 Plus
Dper\GL11030-PA 191 GL11030-PA 22..158 132..259 145 31.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19005-PB 325 GA19005-PB 1..325 1..326 1411 81 Plus
Dpse\GA19173-PA 379 GA19173-PA 22..317 19..313 866 54.5 Plus
Dpse\GA19673-PB 296 GA19673-PB 43..235 41..236 231 31.8 Plus
Dpse\GA19673-PA 296 GA19673-PA 43..235 41..236 231 31.8 Plus
Dpse\GA21314-PA 298 GA21314-PA 5..265 13..259 211 30.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16334-PA 326 GM16334-PA 1..326 1..326 1689 97.2 Plus
Dsec\GM24034-PA 374 GM24034-PA 34..330 28..325 874 54 Plus
Dsec\GM23251-PA 156 GM23251-PA 1..156 171..326 812 98.1 Plus
Dsec\GM20252-PA 294 GM20252-PA 15..233 8..236 238 31.6 Plus
Dsec\GM20345-PA 233 GM20345-PA 3..200 71..259 186 30.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18069-PA 318 GD18069-PA 12..318 20..326 1602 97.7 Plus
Dsim\GD18835-PA 378 GD18835-PA 34..330 28..325 874 54 Plus
Dsim\GD25738-PA 294 GD25738-PA 15..233 8..236 238 31.6 Plus
Dsim\GD25824-PA 299 GD25824-PA 37..266 43..259 224 31.8 Plus
Dsim\GD22351-PA 783 GD22351-PA 73..233 63..220 165 32.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:02:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10690-PA 332 GJ10690-PA 15..327 7..322 1309 76.3 Plus
Dvir\GJ23164-PA 385 GJ23164-PA 33..313 28..309 866 56.7 Plus
Dvir\GJ21004-PA 281 GJ21004-PA 19..220 43..236 229 33.5 Plus
Dvir\GJ20693-PA 293 GJ20693-PA 40..232 41..236 224 31.3 Plus
Dvir\GJ17917-PA 788 GJ17917-PA 78..238 63..220 165 34 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11326-PA 320 GK11326-PA 1..306 1..312 1300 78.7 Plus
Dwil\GK14405-PA 390 GK14405-PA 29..315 15..309 847 55.7 Plus
Dwil\GK17937-PA 295 GK17937-PA 1..234 1..236 234 30.1 Plus
Dwil\GK15915-PA 302 GK15915-PA 40..269 43..259 224 31.2 Plus
Dwil\GK23812-PA 796 GK23812-PA 84..244 63..220 162 33.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10552-PA 310 GE10552-PA 12..310 28..326 1545 96.3 Plus
Dyak\GE26195-PA 378 GE26195-PA 34..330 28..325 877 54.3 Plus
Dyak\GE13337-PA 294 GE13337-PA 15..233 8..236 242 31.2 Plus
Dyak\GE13432-PA 299 GE13432-PA 4..266 8..259 229 30.6 Plus
Dyak\GE10479-PA 783 GE10479-PA 73..233 63..220 165 32.3 Plus