Clone IP11481 Report

Search the DGRC for IP11481

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:114
Well:81
Vector:pOT2
Associated Gene/TranscriptArt6-RA
Protein status:IP11481.pep: gold
Preliminary Size:1026
Sequenced Size:1119

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9927 2005-01-01 Successful iPCR screen
Art6 2008-04-29 Release 5.5 accounting
Art6 2008-08-15 Release 5.9 accounting
Art6 2008-12-18 5.12 accounting

Clone Sequence Records

IP11481.complete Sequence

1119 bp (1119 high quality bases) assembled on 2005-02-26

GenBank Submission: BT022356

> IP11481.complete
AAATTCTATTGCAGCTGAATAATCCTGAAAATGTCTTTTAATGCCAACCA
AAAATTGCCCTTCCTGGAGGGCAAAGATAGCGACTATTTTCAATCCTATT
CCCGCCTGGAGACCCACATGAACATGCTCAGGGACTCGGTGCGCATGCAG
GCTTTTCGCGATGCCATCGTCCAGGATGGAGGGCTATTCCAGGACAAGAT
CGTGCTGGATGTGGGCTGTGGCACGGGTATACTATCCCTTTTCGCCGCCG
AGGCTGGTGCCAGTAAAGTTATAGCCGTTGAATGCACCGATATAGCGGAT
ATAGCCGAGGAGATAATAAGGGACAATCAGAAGGAGAATGTGGTGAAGGT
GGTCAAGGGATTGGTGGAGCAAGTGGAGCTGCCCGACGGCATTGAGAAGG
TGGACATCATAGTTTCCGAATGGATGGGAAATGCTCTGTATATGGAGGCC
ATGATAAACTCCGTGCTGTTTGCCCGGGATAAGTGGCTCACGCGTGGTGG
GCGAATCCTGCCCAGCACTGGAAACCTCTGGTTAATGGGGGCCTATGATC
CGCATCGGCGGACTAATCTTAACTTTTGGTGCAACGTGGAGGGCATCGAC
ATGGGCTGTGTGAGGAAGCCATTCTCCCAGGAGCCCTTGGTGGAGTTTGT
GCCCATCCAGCAGTTGCTCACCGACGAATGCTTCATACACTCCACCAACC
TGGCTGTGGCCCGCAACCAGCCGGTGGAGTTTCAATCGAACTTTCAATTA
AAAGTCATGCGAACTGGAATTATCAATATGCTGGTCCTGTACTTCGATGT
CTTGTTTCCGTCGGGAAAGTCGAACAAATCCGTAAGCCTGACCACCTCGC
CGCATTCGCCATGGACGCACTGGGAGCAGACGGTGCTCCATCTGGATGAG
CCACTGTATGTGAGGATTAGGGATCGGGTGCGCGGTGTGCTGGCCATGAC
GCCCACCGGACAAGATGGACGTGGCATGAACTTTGATCTGCACATCAGCT
TCCGTGGCGAAAGAACGCGAGTGGAGAGCTTCAAGAGCTTCTCCTCACCA
AGATGAACCTGAAGTTCATTTGAAATTTAAAAACATAAGAATGTTGAACC
GAAAAAAAAAAAAAAAAAA

IP11481.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
Art6-RA 1190 Art6-RA 75..1177 1..1103 5515 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9769564..9770237 1101..428 3370 100 Minus
chr3R 27901430 chr3R 9770295..9770722 428..1 2140 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:08:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13944652..13945327 1103..428 3380 100 Minus
3R 32079331 3R 13945385..13945812 428..1 2140 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13685483..13686158 1103..428 3380 100 Minus
3R 31820162 3R 13686216..13686643 428..1 2140 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:36:30 has no hits.

IP11481.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:37:30 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9769564..9770236 429..1101 100 <- Minus
chr3R 9770295..9770722 1..428 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:49:37 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
Art6-RA 1..1026 31..1056 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:17 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
Art6-RA 1..1026 31..1056 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:00:12 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
Art6-RA 1..1026 31..1056 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:16 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
Art6-RA 1..1026 31..1056 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:09:27 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
Art6-RA 1..1026 31..1056 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:18 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
Art6-RA 1..1026 31..1056 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:17 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
Art6-RA 1..1101 1..1101 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:00:12 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
Art6-RA 1..1101 1..1101 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:17 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
Art6-RA 1..1026 31..1056 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:09:27 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
Art6-RA 1..1101 1..1101 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:37:30 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13944654..13945326 429..1101 100 <- Minus
3R 13945385..13945812 1..428 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:37:30 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13944654..13945326 429..1101 100 <- Minus
3R 13945385..13945812 1..428 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:37:30 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13944654..13945326 429..1101 100 <- Minus
3R 13945385..13945812 1..428 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:00:12 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9770376..9771048 429..1101 100 <- Minus
arm_3R 9771107..9771534 1..428 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:00:20 Download gff for IP11481.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13685485..13686157 429..1101 100 <- Minus
3R 13686216..13686643 1..428 100   Minus

IP11481.hyp Sequence

Translation from 30 to 1055

> IP11481.hyp
MSFNANQKLPFLEGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDG
GLFQDKIVLDVGCGTGILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQ
KENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLFARD
KWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFWCNVEGIDMGCVRKPFSQ
EPLVEFVPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINM
LVLYFDVLFPSGKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRV
RGVLAMTPTGQDGRGMNFDLHISFRGERTRVESFKSFSSPR*

IP11481.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
Art6-PA 341 CG9927-PA 1..341 1..341 1780 100 Plus
Art2-PB 355 CG3675-PB 18..346 4..337 705 42.8 Plus
Art2-PA 355 CG3675-PA 18..346 4..337 705 42.8 Plus
Art1-PA 376 CG6554-PA 56..373 19..337 705 40.6 Plus
Art3-PB 474 CG6563-PB 163..464 16..322 521 38.5 Plus

IP11481.pep Sequence

Translation from 30 to 1055

> IP11481.pep
MSFNANQKLPFLEGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDG
GLFQDKIVLDVGCGTGILSLFAAEAGASKVIAVECTDIADIAEEIIRDNQ
KENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMINSVLFARD
KWLTRGGRILPSTGNLWLMGAYDPHRRTNLNFWCNVEGIDMGCVRKPFSQ
EPLVEFVPIQQLLTDECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINM
LVLYFDVLFPSGKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRV
RGVLAMTPTGQDGRGMNFDLHISFRGERTRVESFKSFSSPR*

IP11481.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18899-PA 348 GF18899-PA 19..347 11..339 1248 69.9 Plus
Dana\GF14882-PA 369 GF14882-PA 32..360 4..337 757 44.3 Plus
Dana\GF17088-PA 372 GF17088-PA 52..369 19..337 742 41.2 Plus
Dana\GF11802-PA 520 GF11802-PA 209..519 16..331 522 37.2 Plus
Dana\GF14044-PA 343 GF14044-PA 6..309 19..320 482 39.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17013-PA 345 GG17013-PA 1..343 1..339 1552 84.5 Plus
Dere\GG24386-PA 355 GG24386-PA 18..346 4..337 743 43.4 Plus
Dere\GG17264-PA 397 GG17264-PA 77..394 19..337 742 41.2 Plus
Dere\GG20792-PA 517 GG20792-PA 206..507 16..322 561 40.8 Plus
Dere\GG17314-PA 530 GG17314-PA 138..451 13..322 456 34.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19565-PA 382 GH19565-PA 62..379 19..337 729 40.6 Plus
Dgri\GH18753-PA 507 GH18753-PA 197..507 16..332 546 37.2 Plus
Dgri\GH16647-PA 336 GH16647-PA 26..326 26..335 505 34.5 Plus
Dgri\GH14177-PA 544 GH14177-PA 147..460 13..322 453 34.7 Plus
Dgri\GH13621-PA 342 GH13621-PA 4..274 19..288 434 38 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
Art6-PA 341 CG9927-PA 1..341 1..341 1780 100 Plus
Art2-PB 355 CG3675-PB 18..346 4..337 705 42.8 Plus
Art2-PA 355 CG3675-PA 18..346 4..337 705 42.8 Plus
Art1-PA 376 CG6554-PA 56..373 19..337 705 40.6 Plus
Art3-PB 474 CG6563-PB 163..464 16..322 521 38.5 Plus
Art3-PA 516 CG6563-PA 205..506 16..322 521 38.5 Plus
Art8-PA 341 CG16840-PA 5..309 19..322 448 38.1 Plus
Art4-PB 530 CG5358-PB 138..451 13..322 437 33.6 Plus
Art4-PA 530 CG5358-PA 138..451 13..322 437 33.6 Plus
Art9-PA 313 CG9929-PA 14..289 31..306 409 33.3 Plus
CG32152-PC 357 CG32152-PC 12..281 24..295 367 33.2 Plus
CG32152-PB 357 CG32152-PB 12..281 24..295 367 33.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23860-PA 387 GI23860-PA 67..384 19..337 738 40.9 Plus
Dmoj\GI24669-PA 431 GI24669-PA 121..419 16..320 544 36.7 Plus
Dmoj\GI11605-PA 338 GI11605-PA 28..326 26..335 529 35 Plus
Dmoj\GI20553-PA 341 GI20553-PA 4..309 19..322 462 37.5 Plus
Dmoj\GI22087-PA 539 GI22087-PA 146..459 13..322 451 34.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:38:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23322-PA 351 GL23322-PA 21..349 13..341 1054 57.8 Plus
Dper\GL21930-PA 392 GL21930-PA 72..389 19..337 737 40.6 Plus
Dper\GL16439-PA 366 GL16439-PA 37..355 19..337 681 41.1 Plus
Dper\GL12077-PA 514 GL12077-PA 203..504 16..322 500 36.4 Plus
Dper\GL27288-PA 531 GL27288-PA 138..451 13..322 459 34.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27221-PA 351 GA27221-PA 21..349 13..341 1054 57.8 Plus
Dpse\GA19682-PA 392 GA19682-PA 72..389 19..337 737 40.6 Plus
Dpse\GA17605-PA 366 GA17605-PA 37..355 19..337 691 41.4 Plus
Dpse\GA19687-PA 514 GA19687-PA 203..504 16..322 500 36.4 Plus
Dpse\GA19687-PB 481 GA19687-PB 170..471 16..322 499 36.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25897-PA 444 GM25897-PA 104..442 1..339 1757 95.3 Plus
Dsec\GM18100-PA 355 GM18100-PA 18..346 4..337 733 42.8 Plus
Dsec\GM26148-PA 397 GM26148-PA 77..394 19..337 731 40.6 Plus
Dsec\GM25795-PA 516 GM25795-PA 205..506 16..322 546 40.2 Plus
Dsec\GM11203-PA 341 GM11203-PA 5..309 19..322 462 37.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20467-PA 341 GD20467-PA 1..339 1..339 1742 95.3 Plus
Dsim\GD20702-PA 397 GD20702-PA 77..394 19..337 737 40.6 Plus
Dsim\GD22717-PA 355 GD22717-PA 18..346 4..337 721 42.5 Plus
Dsim\GD20372-PA 477 GD20372-PA 166..467 16..322 545 39.4 Plus
Dsim\GD22203-PA 325 GD22203-PA 5..306 19..319 464 38.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10573-PA 381 GJ10573-PA 61..378 19..337 734 40.6 Plus
Dvir\GJ24043-PA 508 GJ24043-PA 198..496 16..320 532 36.7 Plus
Dvir\GJ11284-PA 311 GJ11284-PA 1..299 33..335 509 35.4 Plus
Dvir\GJ13894-PA 341 GJ13894-PA 2..309 17..322 451 37 Plus
Dvir\GJ24669-PA 292 GJ24669-PA 10..288 31..322 446 35.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22483-PA 344 GK22483-PA 11..338 13..339 970 52.7 Plus
Dwil\GK24448-PA 383 GK24448-PA 48..372 13..337 795 46.2 Plus
Dwil\GK13389-PA 382 GK13389-PA 62..379 19..337 748 42.5 Plus
Dwil\GK12781-PA 517 GK12781-PA 206..505 16..320 521 39.1 Plus
Dwil\GK14886-PA 340 GK14886-PA 2..275 16..290 501 41.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24405-PA 345 GE24405-PA 1..345 1..341 1572 84.3 Plus
Dyak\GE24666-PA 378 GE24666-PA 44..375 4..337 745 40.3 Plus
Dyak\GE14754-PA 355 GE14754-PA 18..346 4..337 725 44 Plus
Dyak\GE26400-PA 516 GE26400-PA 205..506 16..322 552 40.2 Plus
Dyak\GE13077-PA 341 GE13077-PA 5..309 19..322 449 37.2 Plus