Clone IP11482 Report

Search the DGRC for IP11482

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:114
Well:82
Vector:pOT2
Associated Gene/TranscriptCG9962-RA
Protein status:IP11482.pep: gold
Preliminary Size:960
Sequenced Size:1169

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9962 2005-01-01 Successful iPCR screen
CG9962 2008-04-29 Release 5.5 accounting
CG9962 2008-08-15 Release 5.9 accounting
CG9962 2008-12-18 5.12 accounting

Clone Sequence Records

IP11482.complete Sequence

1169 bp (1169 high quality bases) assembled on 2005-02-26

GenBank Submission: BT022360

> IP11482.complete
AAACTGTGACAGTGTGTGTCTGAAGTAAAGCTTCGCAATATAATTATTTA
GCAATTTGTGTCGTCAAAAATAGACATGAACGACTACGAACTGGAAACCA
TGCTCCGCATAAACAGCATCATGGTGATCAGAAAACTAGGATCCGGATCC
TTCGGAGACATCTACGAGGCCAAGCACATGGGGTCAGGACTCCACGTAGC
CCTCAAGGTGGAGCGCAAAAATGCCGGCCAATCGCACTTGAGCATCGAGT
CCACGGTGTACAATCTGCTGAGACATGGTATGGGAATCCCGATGACGTAC
CAGTTTTTCTCAAACAGGCGGCACGACGTGCTGGTCATGGAGTTACTGGG
CCCCTCGTTGGAGACGCTATTCACGATGTGTAATCGCCGCTTCTCCATGA
AGACTGTACTCATGCTGGCTGACCAGATGGTGGACCGTTTGGAGTACCTG
CACCTCCATCACTACGTGCACCGCGACATTAAGCCGGAAAACTTTCTGAT
GGGCGTTGGCCTGACCAGACACCGGCTCCACCTCATCGACTTCGGCCTAT
CCAAGCGGTACTGGGACATGAAGGAGAACAGGCATGTGCCACAAAGGCGC
GGCACAAAGTGGGCCGGCACCGCCCGCTACGCCTCCGTTAACGCCCTTTG
TTGTAAAGTGCAGTCCCGGCGGGACGACTTGGAATCGGTGGGCTACGTCC
TCATTTACCTTTTGCGAGGTAGCCTGCCCTGGCAAGGCCTCTTGCCCAAC
AGCAAGTTGCAGAAGGCGGAGATGATCTTGGAAATGAAGCTGTCCACCTT
GCCGAATAGCCTGTGTGCTGGATATCCAAACGAGTTCTACAACTATATTA
TATACACCCGGCAACTGGGCTTCGAAGAGGAACCGGATTATCGGATGATT
AGGTGCACCTTCTTGAGTTTGCTGTTTAATCTGAAGTTCACCAATGATCT
CATCTACGACTGGGACCACGCCGAGAAGAACAGTGGCAAGAGCGGCTCGG
AGGAAGATAGGGTGGTGGTGAAAAAGGTCGTCTAAGGGCGGCGGACTGCT
GGTAGTACGATGCATATTCCATGTTGAATAAAACCGTCCGACTTTTCTAA
ATGTCACAAATGCCAATTTTGAAATACACAAACTGCCAGCTACCAAAAAA
AAAAAAAAAAAAAAAAAAA

IP11482.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG9962-RA 1144 CG9962-RA 1..1144 1..1144 5720 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2646352..2647493 1144..2 5575 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:08:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2646573..2647720 1148..1 5740 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2646573..2647720 1148..1 5740 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:27:38 has no hits.

IP11482.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:28:50 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2646352..2647493 1..1144 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:49:39 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
CG9962-RA 1..960 76..1035 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:10:37 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
CG9962-RA 1..960 76..1035 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:17:12 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
CG9962-RA 1..960 76..1035 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:55:19 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
CG9962-RA 1..960 76..1035 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:11:17 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
CG9962-RA 1..960 76..1035 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:03:33 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
CG9962-RA 1..960 76..1035 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:10:37 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
CG9962-RA 1..1144 1..1144 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:17:12 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
CG9962-RA 1..1144 1..1144 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:55:20 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
CG9962-RA 1..960 76..1035 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:11:17 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
CG9962-RA 1..1144 1..1144 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:28:50 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2646577..2647720 1..1144 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:28:50 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2646577..2647720 1..1144 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:28:50 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2646577..2647720 1..1144 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:17:12 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2646577..2647720 1..1144 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:30:30 Download gff for IP11482.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2646577..2647720 1..1144 100   Minus

IP11482.hyp Sequence

Translation from 75 to 1034

> IP11482.hyp
MNDYELETMLRINSIMVIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNA
GQSHLSIESTVYNLLRHGMGIPMTYQFFSNRRHDVLVMELLGPSLETLFT
MCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGVGLTRHR
LHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRD
DLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGY
PNEFYNYIIYTRQLGFEEEPDYRMIRCTFLSLLFNLKFTNDLIYDWDHAE
KNSGKSGSEEDRVVVKKVV*

IP11482.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG9962-PA 319 CG9962-PA 1..319 1..319 1683 100 Plus
dco-PD 440 CG2048-PD 7..291 13..297 720 49.5 Plus
dco-PC 440 CG2048-PC 7..291 13..297 720 49.5 Plus
dco-PB 440 CG2048-PB 7..291 13..297 720 49.5 Plus
dco-PA 440 CG2048-PA 7..291 13..297 720 49.5 Plus

IP11482.pep Sequence

Translation from 75 to 1034

> IP11482.pep
MNDYELETMLRINSIMVIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNA
GQSHLSIESTVYNLLRHGMGIPMTYQFFSNRRHDVLVMELLGPSLETLFT
MCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGVGLTRHR
LHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRD
DLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGY
PNEFYNYIIYTRQLGFEEEPDYRMIRCTFLSLLFNLKFTNDLIYDWDHAE
KNSGKSGSEEDRVVVKKVV*

IP11482.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13879-PA 415 GF13879-PA 17..326 12..315 887 54.8 Plus
Dana\GF23293-PA 441 GF23293-PA 3..291 10..297 729 49.5 Plus
Dana\GF21383-PA 337 GF21383-PA 22..301 17..296 714 51.1 Plus
Dana\GF19391-PA 344 GF19391-PA 12..299 10..297 703 49 Plus
Dana\GF15092-PA 388 GF15092-PA 19..309 6..296 691 48.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24503-PA 316 GG24503-PA 1..312 1..311 1142 68.6 Plus
Dere\GG11892-PA 440 GG11892-PA 3..291 10..297 729 49.5 Plus
Dere\GG17734-PA 337 GG17734-PA 22..301 17..296 714 51.1 Plus
Dere\GG21733-PA 394 GG21733-PA 18..324 6..312 695 45.9 Plus
Dere\GG17715-PA 344 GG17715-PA 12..313 10..304 681 46 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:49:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12114-PA 343 GH12114-PA 22..301 17..296 734 51.8 Plus
Dgri\GH14346-PA 439 GH14346-PA 3..291 10..297 730 49.5 Plus
Dgri\GH17562-PA 345 GH17562-PA 22..299 20..297 718 50.7 Plus
Dgri\GH12595-PA 343 GH12595-PA 22..301 17..296 718 51.4 Plus
Dgri\GH22602-PA 366 GH22602-PA 31..305 21..296 699 51.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG9962-PA 319 CG9962-PA 1..319 1..319 1683 100 Plus
dco-PE 440 CG2048-PE 7..291 13..297 720 49.5 Plus
dco-PD 440 CG2048-PD 7..291 13..297 720 49.5 Plus
dco-PC 440 CG2048-PC 7..291 13..297 720 49.5 Plus
dco-PB 440 CG2048-PB 7..291 13..297 720 49.5 Plus
dco-PA 440 CG2048-PA 7..291 13..297 720 49.5 Plus
CkIalpha-PG 337 CG2028-PG 22..301 17..296 707 51.1 Plus
CkIalpha-PF 337 CG2028-PF 22..301 17..296 707 51.1 Plus
CkIalpha-PD 337 CG2028-PD 22..301 17..296 707 51.1 Plus
CkIalpha-PE 337 CG2028-PE 22..301 17..296 707 51.1 Plus
CkIalpha-PA 337 CG2028-PA 22..301 17..296 707 51.1 Plus
CkIalpha-PB 337 CG2028-PB 22..301 17..296 707 51.1 Plus
CG2577-PA 344 CG2577-PA 12..313 10..304 676 46 Plus
CG7094-PA 390 CG7094-PA 18..308 6..296 671 46.7 Plus
CG12147-PA 477 CG12147-PA 70..379 17..317 642 42.1 Plus
gish-PA 422 CG6963-PA 25..305 19..296 627 43.8 Plus
gish-PE 463 CG6963-PE 66..346 19..296 627 43.8 Plus
gish-PF 358 CG6963-PF 66..351 19..296 597 42.7 Plus
gish-PC 427 CG6963-PC 25..310 19..296 597 42.7 Plus
gish-PM 468 CG6963-PM 66..351 19..296 597 42.7 Plus
gish-PH 468 CG6963-PH 66..351 19..296 597 42.7 Plus
gish-PD 468 CG6963-PD 66..351 19..296 597 42.7 Plus
gish-PB 468 CG6963-PB 66..351 19..296 597 42.7 Plus
gish-PI 474 CG6963-PI 66..351 19..296 597 42.7 Plus
gish-PG 476 CG6963-PG 74..359 19..296 597 42.7 Plus
gish-PL 537 CG6963-PL 66..351 19..296 597 42.7 Plus
gish-PK 496 CG6963-PK 66..373 19..296 570 40.3 Plus
gish-PJ 521 CG6963-PJ 94..376 22..296 567 42 Plus
Asator-PF 811 CG11533-PF 19..300 17..303 314 30.1 Plus
Asator-PK 1106 CG11533-PK 19..300 17..303 314 30.1 Plus
Asator-PL 1106 CG11533-PL 19..300 17..303 314 30.1 Plus
Asator-PG 1144 CG11533-PG 175..456 17..303 314 30.1 Plus
Asator-PH 1193 CG11533-PH 19..300 17..303 314 30.1 Plus
Asator-PJ 1261 CG11533-PJ 174..455 17..303 314 30.1 Plus
Asator-PE 1262 CG11533-PE 175..456 17..303 314 30.1 Plus
Asator-PI 1348 CG11533-PI 174..455 17..303 314 30.1 Plus
Asator-PD 1349 CG11533-PD 175..456 17..303 314 30.1 Plus
ball-PB 599 CG6386-PB 53..340 21..291 235 31.4 Plus
ball-PA 599 CG6386-PA 53..340 21..291 235 31.4 Plus
CG4839-PA 1003 CG4839-PA 684..893 2..222 193 27.1 Plus
CG4839-PB 1003 CG4839-PB 684..893 2..222 193 27.1 Plus
PKD-PF 836 CG7125-PF 530..743 2..219 192 27 Plus
PKD-PE 836 CG7125-PE 530..743 2..219 192 27 Plus
PKD-PD 836 CG7125-PD 530..743 2..219 192 27 Plus
PKD-PC 836 CG7125-PC 530..743 2..219 192 27 Plus
PKD-PB 836 CG7125-PB 530..743 2..219 192 27 Plus
PKD-PA 836 CG7125-PA 530..743 2..219 192 27 Plus
PKD-PG 906 CG7125-PG 530..743 2..219 192 27 Plus
hep-PE 492 CG4353-PE 194..447 12..272 164 24.7 Plus
hep-PC 492 CG4353-PC 194..447 12..272 164 24.7 Plus
hep-PF 1153 CG4353-PF 194..447 12..272 164 24.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22988-PA 328 GI22988-PA 15..296 12..296 741 49.8 Plus
Dmoj\GI16325-PA 343 GI16325-PA 22..301 17..296 722 51.1 Plus
Dmoj\GI16225-PA 343 GI16225-PA 22..301 17..296 705 50.7 Plus
Dmoj\GI16025-PA 344 GI16025-PA 14..299 12..297 689 47.9 Plus
Dmoj\GI23642-PA 380 GI23642-PA 30..318 17..306 681 48.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25396-PA 345 GL25396-PA 11..298 10..297 710 48.3 Plus
Dper\GL15889-PA 374 GL15889-PA 36..315 17..296 689 48.9 Plus
Dper\GL13140-PA 288 GL13140-PA 22..288 17..283 685 51.7 Plus
Dper\GL22167-PA 475 GL22167-PA 141..445 17..319 617 43.8 Plus
Dper\GL21596-PA 468 GL21596-PA 64..351 17..296 604 42.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15205-PD 439 GA15205-PD 3..291 10..297 730 49.5 Plus
Dpse\GA15205-PB 439 GA15205-PB 3..291 10..297 730 49.5 Plus
Dpse\GA15193-PA 337 GA15193-PA 22..301 17..296 716 51.4 Plus
Dpse\GA15396-PA 345 GA15396-PA 11..298 10..297 708 48.3 Plus
Dpse\GA20096-PA 374 GA20096-PA 36..315 17..296 690 48.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18209-PA 325 GM18209-PA 1..317 1..317 1453 84.9 Plus
Dsec\GM12110-PA 440 GM12110-PA 3..291 10..297 729 49.5 Plus
Dsec\GM11579-PA 337 GM11579-PA 22..301 17..296 715 51.1 Plus
Dsec\GM11559-PA 344 GM11559-PA 12..313 10..304 680 46 Plus
Dsec\GM17114-PA 379 GM17114-PA 18..308 6..296 678 46.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22814-PA 319 GD22814-PA 1..319 1..319 1485 85.6 Plus
Dsim\GD16644-PA 395 GD16644-PA 3..291 10..297 728 49.5 Plus
Dsim\GD17076-PA 344 GD17076-PA 12..313 10..304 680 46 Plus
Dsim\GD19086-PA 476 GD19086-PA 72..359 17..296 605 42.7 Plus
Dsim\GD24797-PA 157 GD24797-PA 22..149 17..144 352 53.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23524-PA 328 GJ23524-PA 11..316 7..313 795 48.9 Plus
Dvir\GJ15665-PA 343 GJ15665-PA 22..301 17..296 734 51.8 Plus
Dvir\GJ10658-PA 443 GJ10658-PA 3..291 10..297 723 49.1 Plus
Dvir\GJ15916-PA 343 GJ15916-PA 22..301 17..296 712 51.1 Plus
Dvir\GJ16877-PA 344 GJ16877-PA 22..322 20..316 711 49.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24490-PA 325 GK24490-PA 14..298 12..296 745 50.2 Plus
Dwil\GK22559-PA 425 GK22559-PA 3..291 10..297 730 49.5 Plus
Dwil\GK25517-PA 337 GK25517-PA 22..301 17..296 719 51.4 Plus
Dwil\GK18163-PA 397 GK18163-PA 18..308 6..296 690 46.4 Plus
Dwil\GK19238-PA 334 GK19238-PA 14..299 12..297 664 46.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15064-PA 319 GE15064-PA 1..307 1..307 1264 75.2 Plus
Dyak\GE23340-PA 440 GE23340-PA 3..291 10..297 729 49.5 Plus
Dyak\GE17024-PA 337 GE17024-PA 22..301 17..296 715 51.1 Plus
Dyak\GE13122-PA 390 GE13122-PA 18..317 6..305 692 46.3 Plus
Dyak\GE25283-PA 480 GE25283-PA 76..375 17..312 637 41.5 Plus