Clone IP11483 Report

Search the DGRC for IP11483

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:114
Well:83
Vector:pOT2
Associated Gene/TranscriptCG9997-RA
Protein status:IP11483.pep: validated not full length
Preliminary Size:993
Sequenced Size:1038

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9997 2005-01-01 Successful iPCR screen
CG9997 2008-04-29 Release 5.5 accounting
CG9997 2008-08-15 Release 5.9 accounting
CG9997 2008-12-18 5.12 accounting

Clone Sequence Records

IP11483.complete Sequence

1038 bp (1038 high quality bases) assembled on 2005-05-04

GenBank Submission: BT022364

> IP11483.complete
CCACTGTGCATTATTCAGATCCTTTTGCTCGCTTTCCTGGCGAACGAGTC
GGAATCCTCGAACACTCATCTCCATCGCTATATGCTGGACACCTATAAGC
CGCAGCACAATCGAAAAACCCAAATGAACTACAAACGACGCCGTACTGTA
AGGAGCGATCACGAAATGGCTATCGATCCCAATAATCCAAATAATCCCAA
TAATCCAAATAATTCCGATAGTCCCGATAATCCCAATAATCTCAATAATC
CAAATAATCCGAATAATGACACAGTACAGTATGGACATTCCAAGGAGCCT
GTAGTTACCTTGACCAATTCGGACAAGAAGGTGCCGCTGCACGAGCTGAT
GGTGAGACTCTATCAGCAAAACAAATATATCTGCATGGGCACGGTGATAT
CCGAGATGCTAGTGATTACCACTAGCACTTGTTTTAATTTGGCCAGCAGT
GAAGTGGTCACGATGAAGATGTACGATGACGAAGTCCTCGAAGGGAAAAG
AGTCGCTCTCAACCAGACCTACCTTAAAGGAGCGGATCCCATGCTGGTTG
CTATTCAACTAACCAAGTCCCCAAAGAATTCCAAAGTGACTGGTGACACC
GTGAAGCTGTGCGATTCGGAGCTAGAAATATACGAGCCCATCGAGCTGCC
ACTGTGGATCAGGAGTCGCCACAGTATTCACTCGCAGACAACGTACATCA
TACCGATGCAGGCGTGCCGACTCCGCATGAGGGATCCCGAAGCGATGGTC
GCCACCGACACTATGATCTGCGTGAAGAACATGAAGTATACGGCCCAGTG
CCAGTTGGCCATGGGTAATCCCCTCGTTCACGACGAACGCATCTGCGGCA
TCAATGTGGCTGGTCACAACTGTCCCGCCTACACGGGCGTGGATCTATAC
ATCAGGGTATACGATGCTCTCGCCTTCTCGATAATGGGCATGGAAATCAT
TAAAAACTCCCGCATAGAAGATACCATTTTGTAAAGGGTTGGCTCAATCC
ATTAAATATTATAACAATTTTAAAAAAAAAAAAAAAAA

IP11483.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG9997.a 1129 CG9997.a 10..1038 1..1029 5115 99.8 Plus
CG9997-RA 993 CG9997-RA 10..993 1..984 4920 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:47:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24578985..24580005 1021..1 5060 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:08:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:47:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28755942..28756970 1029..1 5115 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28496773..28497801 1029..1 5115 99.8 Minus
Blast to na_te.dros performed on 2019-03-16 15:47:27 has no hits.

IP11483.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:48:43 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24578985..24579738 268..1021 99 == Minus
chr3R 24579831..24580005 1..175 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:49:40 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 10..993 1..984 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:40:56 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 10..993 1..984 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:54:05 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 10..993 1..984 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:17:05 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 10..993 1..984 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:53:55 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 10..993 1..984 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:14:21 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 10..993 1..984 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:40:56 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 10..1030 1..1021 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:54:05 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 10..1030 1..1021 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:17:05 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 10..993 1..984 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:53:55 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 10..1030 1..1021 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:48:43 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28755950..28756970 1..1021 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:48:43 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28755950..28756970 1..1021 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:48:43 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28755950..28756970 1..1021 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:54:05 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24581672..24582692 1..1021 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:03:15 Download gff for IP11483.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28496781..28497801 1..1021 100   Minus

IP11483.pep Sequence

Translation from 0 to 983

> IP11483.pep
PLCIIQILLLAFLANESESSNTHLHRYMLDTYKPQHNRKTQMNYKRRRTV
RSDHEMAIDPNNPNNPNNPNNSDSPDNPNNLNNPNNPNNDTVQYGHSKEP
VVTLTNSDKKVPLHELMVRLYQQNKYICMGTVISEMLVITTSTCFNLASS
EVVTMKMYDDEVLEGKRVALNQTYLKGADPMLVAIQLTKSPKNSKVTGDT
VKLCDSELEIYEPIELPLWIRSRHSIHSQTTYIIPMQACRLRMRDPEAMV
ATDTMICVKNMKYTAQCQLAMGNPLVHDERICGINVAGHNCPAYTGVDLY
IRVYDALAFSIMGMEIIKNSRIEDTIL*

IP11483.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:30:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16430-PA 305 GF16430-PA 16..305 11..327 748 47.3 Plus
Dana\GF18587-PA 222 GF18587-PA 6..210 105..306 173 27.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:30:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12056-PA 303 GG12056-PA 14..303 11..327 1295 76 Plus
Dere\GG11612-PA 298 GG11612-PA 82..285 99..306 170 25.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG9997-PB 330 CG9997-PB 4..330 1..327 1728 100 Plus
CG9997-PA 330 CG9997-PA 4..330 1..327 1728 100 Plus
intr-PA 298 CG12558-PA 102..285 117..306 169 25.1 Plus
Sems-PA 275 CG10586-PA 59..270 117..317 150 24.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10529-PA 299 GI10529-PA 27..299 23..327 239 27.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13690-PA 302 GL13690-PA 22..302 15..327 492 34 Plus
Dper\GL13800-PA 315 GL13800-PA 84..306 86..309 189 28 Plus
Dper\GL13799-PA 249 GL13799-PA 47..231 108..301 155 23.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22176-PA 302 GA22176-PA 22..302 15..327 496 34.3 Plus
Dpse\GA26991-PA 284 GA26991-PA 61..284 103..327 221 24.8 Plus
Dpse\GA11693-PA 315 GA11693-PA 84..306 86..309 188 28 Plus
Dpse\GA26803-PA 249 GA26803-PA 47..231 108..301 160 22.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12285-PA 330 GM12285-PA 4..330 1..327 1505 94.8 Plus
Dsec\GM12735-PA 298 GM12735-PA 91..285 105..306 167 27.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18020-PA 330 GD18020-PA 4..330 1..327 1475 93 Plus
Dsim\GD21380-PA 298 GD21380-PA 91..285 105..306 154 28.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24181-PA 270 GJ24181-PA 2..270 23..327 402 29.8 Plus
Dvir\GJ24183-PA 151 GJ24183-PA 27..151 203..327 169 27.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10986-PA 301 GK10986-PA 26..301 21..327 487 35.8 Plus
Dwil\GK12104-PA 289 GK12104-PA 92..280 113..309 183 27.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10497-PA 303 GE10497-PA 4..303 1..327 1336 76.5 Plus
Dyak\GE23799-PA 335 GE23799-PA 134..322 112..306 171 25.9 Plus

IP11483.hyp Sequence

Translation from 0 to 983

> IP11483.hyp
PLCIIQILLLAFLANESESSNTHLHRYMLDTYKPQHNRKTQMNYKRRRTV
RSDHEMAIDPNNPNNPNNPNNSDSPDNPNNLNNPNNPNNDTVQYGHSKEP
VVTLTNSDKKVPLHELMVRLYQQNKYICMGTVISEMLVITTSTCFNLASS
EVVTMKMYDDEVLEGKRVALNQTYLKGADPMLVAIQLTKSPKNSKVTGDT
VKLCDSELEIYEPIELPLWIRSRHSIHSQTTYIIPMQACRLRMRDPEAMV
ATDTMICVKNMKYTAQCQLAMGNPLVHDERICGINVAGHNCPAYTGVDLY
IRVYDALAFSIMGMEIIKNSRIEDTIL*

IP11483.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG9997-PB 330 CG9997-PB 4..330 1..327 1728 100 Plus
CG9997-PA 330 CG9997-PA 4..330 1..327 1728 100 Plus
intr-PA 298 CG12558-PA 102..285 117..306 169 25.1 Plus
Sems-PA 275 CG10586-PA 59..270 117..317 150 24.2 Plus