Clone IP11583 Report

Search the DGRC for IP11583

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:115
Well:83
Vector:pOT2
Associated Gene/TranscriptCG9997-RA
Protein status:IP11583.pep: validated not full length
Preliminary Size:993
Sequenced Size:1005

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9997 2005-01-01 Successful iPCR screen
CG9997 2008-04-29 Release 5.5 accounting
CG9997 2008-08-15 Release 5.9 accounting
CG9997 2008-12-18 5.12 accounting

Clone Sequence Records

IP11583.complete Sequence

1005 bp (1005 high quality bases) assembled on 2005-04-11

GenBank Submission: BT022420

> IP11583.complete
CGACCACTGTGCATTATTCAGATCCTTTTGCTCGCTTTCCTGGCGAACGA
GTCGGAATCCTCGAACACTCATCTCCATCGCTATATGCTGGACACCTATA
AGCCGCAGCACAATCGAAAAACCCAAATGAACTACAAACGACGCCGTACT
GTAAGGAGCGATCACGAAATGGCTATCGATCCCAATAATCCAAATAATCC
CAATAATCCAAATAATTCCGATAGTCCCGATAATCCCAATAATCTCAATA
ATCCAAATAATCCGAATAATGACACAGTACAGTATGGACATTCCAAGGAG
CCTGTAGTTACCTTGACCAATTCGGACAAGAAGGTGCCGCTGCACGAGCT
GATGGTGAGACTCTATCAGCAAAACAAATATATCTGCATGGGCACGGTGA
TATCCGAGATGCTAGTGATTACCACTAGCACTTGTTTTAATTTGGCCAGC
AGTGAAGTGGTCACGATGAAGATGTACGATGACGAAGTCCTCGAAGGGAA
AAGAGTCGCTCTCAACCAGACCTACCTTAAAGGAGCGGATCCCATGCTGG
TTGCTATTCAACTAACCAAGTCCCCAAAGAATTCCAAAGTGACTGGTGAC
ACCGTGAAGCTGTGCGATTCGGAGCTAGAAATATACGAGCCCATCGAGCT
GCCACTGTGGATCAGGAGTCGCCACAGTATTCACTCGCAGACAACGTACA
TCATACCGATGCAGGCGTGCCGACTCCGCATGAGGGATCCCGAAGCGATG
GTCGCCACCGACACTATGATCTGCGTGAAGAACATGAAGTATACGGCCCA
GTGCCAGTTGGCCATGGGTAATCCCCTCGTTCACGACGAACGCATCTGCG
GCATCAATGTGGCTGGTCACAACTGTCCCGCCTACACGGGCGTGGATCTA
TACATCAGGGTATACGATGCTCTCGCCTTCTCGATAATGGGCATGGAAAT
CATTAAAAACTCCCGCATAGAAGATACCATTTTGTAAAAAAAAAAAAAAA
AAAAA

IP11583.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG9997.a 1129 CG9997.a 7..994 1..988 4940 100 Plus
CG9997-RA 993 CG9997-RA 7..993 1..987 4935 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24579024..24580008 985..1 4880 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:09:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28755986..28756973 988..1 4940 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28496817..28497804 988..1 4940 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:52:30 has no hits.

IP11583.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:53:19 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24579024..24579738 271..985 99 == Minus
chr3R 24579831..24580008 1..178 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:49:52 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 7..991 1..985 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:04:37 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 7..991 1..985 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:10:30 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 7..993 1..987 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:49:44 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 7..991 1..985 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:44:03 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 7..993 1..987 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:51:37 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 7..991 1..985 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:04:37 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 7..991 1..985 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:10:30 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 7..991 1..985 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:49:44 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 7..991 1..985 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:44:03 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
CG9997-RA 7..991 1..985 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:53:19 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28755989..28756973 1..985 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:53:19 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28755989..28756973 1..985 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:53:19 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28755989..28756973 1..985 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:10:30 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24581711..24582695 1..985 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:24:24 Download gff for IP11583.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28496820..28497804 1..985 100   Minus

IP11583.pep Sequence

Translation from 0 to 986

> IP11583.pep
RPLCIIQILLLAFLANESESSNTHLHRYMLDTYKPQHNRKTQMNYKRRRT
VRSDHEMAIDPNNPNNPNNPNNSDSPDNPNNLNNPNNPNNDTVQYGHSKE
PVVTLTNSDKKVPLHELMVRLYQQNKYICMGTVISEMLVITTSTCFNLAS
SEVVTMKMYDDEVLEGKRVALNQTYLKGADPMLVAIQLTKSPKNSKVTGD
TVKLCDSELEIYEPIELPLWIRSRHSIHSQTTYIIPMQACRLRMRDPEAM
VATDTMICVKNMKYTAQCQLAMGNPLVHDERICGINVAGHNCPAYTGVDL
YIRVYDALAFSIMGMEIIKNSRIEDTIL*

IP11583.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16430-PA 305 GF16430-PA 16..305 12..328 748 47.3 Plus
Dana\GF18587-PA 222 GF18587-PA 6..210 106..307 173 27.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12056-PA 303 GG12056-PA 14..303 12..328 1295 76 Plus
Dere\GG11612-PA 298 GG11612-PA 82..285 100..307 170 25.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG9997-PB 330 CG9997-PB 3..330 1..328 1733 100 Plus
CG9997-PA 330 CG9997-PA 3..330 1..328 1733 100 Plus
intr-PA 298 CG12558-PA 102..285 118..307 169 25.1 Plus
Sems-PA 275 CG10586-PA 59..270 118..318 150 24.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10529-PA 299 GI10529-PA 27..299 24..328 239 27.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13690-PA 302 GL13690-PA 22..302 16..328 492 34 Plus
Dper\GL13800-PA 315 GL13800-PA 84..306 87..310 189 28 Plus
Dper\GL13799-PA 249 GL13799-PA 47..231 109..302 155 23.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22176-PA 302 GA22176-PA 22..302 16..328 496 34.3 Plus
Dpse\GA26991-PA 284 GA26991-PA 61..284 104..328 221 24.8 Plus
Dpse\GA11693-PA 315 GA11693-PA 84..306 87..310 188 28 Plus
Dpse\GA26803-PA 249 GA26803-PA 47..231 109..302 160 23.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12285-PA 330 GM12285-PA 4..330 2..328 1504 94.8 Plus
Dsec\GM12735-PA 298 GM12735-PA 91..285 106..307 167 27.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18020-PA 330 GD18020-PA 4..330 2..328 1476 93 Plus
Dsim\GD21380-PA 298 GD21380-PA 91..285 106..307 154 28.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24181-PA 270 GJ24181-PA 2..270 24..328 402 29.7 Plus
Dvir\GJ24183-PA 151 GJ24183-PA 27..151 204..328 169 27.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10986-PA 301 GK10986-PA 26..301 22..328 487 35.8 Plus
Dwil\GK12104-PA 289 GK12104-PA 92..280 114..310 183 27.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10497-PA 303 GE10497-PA 3..303 1..328 1342 76.5 Plus
Dyak\GE23799-PA 335 GE23799-PA 134..322 113..307 171 25.9 Plus

IP11583.hyp Sequence

Translation from 0 to 984

> IP11583.hyp
RPLCIIQILLLAFLANESESSNTHLHRYMLDTYKPQHNRKTQMNYKRRRT
VRSDHEMAIDPNNPNNPNNPNNSDSPDNPNNLNNPNNPNNDTVQYGHSKE
PVVTLTNSDKKVPLHELMVRLYQQNKYICMGTVISEMLVITTSTCFNLAS
SEVVTMKMYDDEVLEGKRVALNQTYLKGADPMLVAIQLTKSPKNSKVTGD
TVKLCDSELEIYEPIELPLWIRSRHSIHSQTTYIIPMQACRLRMRDPEAM
VATDTMICVKNMKYTAQCQLAMGNPLVHDERICGINVAGHNCPAYTGVDL
YIRVYDALAFSIMGMEIIKNSRIEDTIL

IP11583.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG9997-PB 330 CG9997-PB 3..330 1..328 1733 100 Plus
CG9997-PA 330 CG9997-PA 3..330 1..328 1733 100 Plus
intr-PA 298 CG12558-PA 102..285 118..307 169 25.1 Plus
Sems-PA 275 CG10586-PA 59..270 118..318 150 24.2 Plus