Clone IP11947 Report

Search the DGRC for IP11947

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:119
Well:47
Vector:pOT2
Associated Gene/TranscriptCG34426-RA
Protein status:IP11947.pep: gold
Preliminary Size:1317
Sequenced Size:1040

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13307 2005-01-01 Successful iPCR screen
CG34426 2008-04-29 Release 5.5 accounting
CG34426 2008-08-15 Release 5.9 accounting
CG34426 2008-12-18 5.12 accounting

Clone Sequence Records

IP11947.complete Sequence

1040 bp (1040 high quality bases) assembled on 2005-04-11

GenBank Submission: BT022596

> IP11947.complete
TTCATGTTGATCGTACTACTGAGTGCTCTTGTGGCACCGTCAATTGTCAG
TGCCGCATGTGGCCAGTGTGTGGATGCGCACAGTTGCATCGGTGAATCGG
AGTTTCAGTTGTGCTACGATGGTGTCCGGGACCAGACTATCAACTACACT
TGCCCCGAATCAAAACCCATTTGCACAACCTACGGAATTATTTGCATGCC
CAACGGCACGAGTATAGAACGCGGCTGTGGTGATGTCTCCAATTGTGGTG
TTTGCTCAGAATCCACAACTTTTGCCTGTACTTCAAGGACCACATTTGCT
GTTTGCAACGGTGATGTTGTTTCCGCCAATAGTTTCGACTGTGCAGAAGA
CTTTGTCTGCAGTGTTAAAAATGCAGCCAGCGGAAGTCCTTGTATTTCCC
GGTGTGACTCATCAGACTCAGATATTTGTGATCGAGTTTTGGAACCCGAA
GTGGAAAGCACCACGGCATCAGTGACTCCCACTGTCACATCCACAGTCAC
TCCCATTGAGACTACTGCAGACCCATCCACAGTCATCACTGATTCATCGA
CAGGATCAACTGGGGATACCTCCACTGGATCGTCTTCCGTAACTTCGTCG
GACACATCAACGGACAGCACCGTGACTGTCACTGATTCAGGAAGCACTAC
CCAAAGTACTGCAACAACTCCAGCATTCAATGAAGACACCTATTGCCAAG
AGATCAACTCAACGGGTCGCTATCCCATACCCAATGACACAGTGTGCACT
AGCTACATCTACTGTGTTCTAAGGAGTGGAAGCTGGGCAGGATTGCTCTA
TAATTGCAACGTGCAGAGACCTTATTTCGATGCTGATGTCTTCAGCTGTG
GTACTGTGAAGCCATCTTATGCCGGATGCACTAATTTAGTCTAAATCGAT
TTAATATGTCACTCTAATATATAGTACGCCATTTTATTTAGTAAACGAAA
TTAAAAACGGTACTTTAATGAATAGAAATATTTCCTCTCTAAAAAAAGGT
AAAAAAAACTTGTATAAAAAAAAAAAAAAAAAAAAAAAAA

IP11947.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG34426-RA 1079 CG34426-RA 64..1071 1..1008 5040 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:23:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8794582..8795213 121..752 3145 99.8 Plus
chr3L 24539361 chr3L 8795277..8795534 751..1008 1290 100 Plus
chr3L 24539361 chr3L 8794410..8794532 1..123 585 98.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:12:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:23:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8802639..8803270 121..752 3160 100 Plus
3L 28110227 3L 8803334..8803591 751..1008 1290 100 Plus
3L 28110227 3L 8802469..8802591 1..123 615 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8795739..8796370 121..752 3160 100 Plus
3L 28103327 3L 8796434..8796691 751..1008 1290 100 Plus
3L 28103327 3L 8795569..8795691 1..123 615 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:23:41 has no hits.

IP11947.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:24:57 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8795279..8795542 753..1015 99   Plus
chr3L 8794410..8794530 1..121 98 -> Plus
chr3L 8794583..8795213 122..752 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:50:57 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
CG34426-RA 1..891 4..894 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:04:09 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
CG34426-RA 1..891 4..894 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:08:40 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
CG34426-RA 1..891 4..894 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:49:19 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
CG34426-RA 1..891 4..894 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:25:55 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
CG34426-RA 1..891 4..894 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:50:41 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
CG34426-RA 7..1022 1..1015 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:04:09 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
CG34426-RA 7..1022 1..1015 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:08:40 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
CG34426-RA 7..1022 1..1015 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:49:19 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
CG34426-RA 7..1022 1..1015 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:25:55 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
CG34426-RA 7..1022 1..1015 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:57 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8802469..8802589 1..121 100 -> Plus
3L 8802640..8803270 122..752 100 -> Plus
3L 8803336..8803599 753..1015 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:57 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8802469..8802589 1..121 100 -> Plus
3L 8802640..8803270 122..752 100 -> Plus
3L 8803336..8803599 753..1015 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:57 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8802469..8802589 1..121 100 -> Plus
3L 8802640..8803270 122..752 100 -> Plus
3L 8803336..8803599 753..1015 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:08:40 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8795569..8795689 1..121 100 -> Plus
arm_3L 8795740..8796370 122..752 100 -> Plus
arm_3L 8796436..8796699 753..1015 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:23:56 Download gff for IP11947.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8795740..8796370 122..752 100 -> Plus
3L 8796436..8796699 753..1015 99   Plus
3L 8795569..8795689 1..121 100 -> Plus

IP11947.pep Sequence

Translation from 0 to 893

> IP11947.pep
FMLIVLLSALVAPSIVSAACGQCVDAHSCIGESEFQLCYDGVRDQTINYT
CPESKPICTTYGIICMPNGTSIERGCGDVSNCGVCSESTTFACTSRTTFA
VCNGDVVSANSFDCAEDFVCSVKNAASGSPCISRCDSSDSDICDRVLEPE
VESTTASVTPTVTSTVTPIETTADPSTVITDSSTGSTGDTSTGSSSVTSS
DTSTDSTVTVTDSGSTTQSTATTPAFNEDTYCQEINSTGRYPIPNDTVCT
SYIYCVLRSGSWAGLLYNCNVQRPYFDADVFSCGTVKPSYAGCTNLV*

IP11947.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24356-PA 320 GF24356-PA 4..173 1..169 458 52.9 Plus
Dana\GF20111-PA 145 GF20111-PA 8..141 10..145 164 32.9 Plus
Dana\GF10145-PA 151 GF10145-PA 10..149 3..145 142 29.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14349-PA 505 GG14349-PA 5..259 2..251 879 76.5 Plus
Dere\GG15057-PA 154 GG15057-PA 10..150 1..145 177 33.6 Plus
Dere\GG15056-PA 158 GG15056-PA 13..152 4..145 166 35.8 Plus
Dere\GG14350-PA 209 GG14350-PA 146..206 229..289 150 42.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15329-PA 430 GH15329-PA 10..153 4..146 277 41.8 Plus
Dgri\GH16137-PA 150 GH16137-PA 1..132 1..136 155 34.5 Plus
Dgri\GH10924-PA 155 GH10924-PA 7..109 2..104 144 33.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG34426-PA 296 CG34426-PA 1..296 2..297 1575 100 Plus
CG13312-PA 342 CG13312-PA 14..330 2..294 272 28.1 Plus
CG34427-PB 269 CG34427-PB 12..267 2..290 252 30.2 Plus
CG42525-PB 377 CG42525-PB 152..375 78..289 235 28.4 Plus
CG42525-PA 419 CG42525-PA 194..417 78..289 235 28.4 Plus
CG42494-PC 283 CG42494-PC 17..283 80..294 224 26.5 Plus
CG42494-PB 283 CG42494-PB 17..283 80..294 224 26.5 Plus
CG42494-PA 283 CG42494-PA 17..283 80..294 224 26.5 Plus
CG13311-PA 153 CG13311-PA 12..149 3..145 214 32.2 Plus
CG13308-PB 233 CG13308-PB 24..223 81..295 203 29.1 Plus
CG32024-PA 209 CG32024-PA 21..206 80..289 194 25 Plus
CG14958-PA 145 CG14958-PA 7..142 7..143 188 33.8 Plus
CG13309-PA 229 CG13309-PA 17..225 18..237 182 27.7 Plus
CG13075-PB 339 CG13075-PB 7..249 4..289 180 21 Plus
Muc96D-PA 881 CG31439-PA 45..256 33..251 176 25.8 Plus
CG13309-PA 229 CG13309-PA 19..218 82..297 147 26.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12930-PA 293 GI12930-PA 23..292 16..293 410 37.3 Plus
Dmoj\GI12932-PA 230 GI12932-PA 128..227 193..293 145 36.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:27:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28198-PA 466 GA28198-PA 11..218 3..217 446 45.2 Plus
Dpse\GA12192-PA 156 GA12192-PA 12..153 3..145 153 30.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:27:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25093-PA 300 GM25093-PA 4..300 1..297 1233 91.6 Plus
Dsec\GM24914-PA 153 GM24914-PA 36..149 28..145 154 35 Plus
Dsec\GM24913-PA 168 GM24913-PA 13..154 4..145 147 33.3 Plus
Dsec\GM14547-PA 145 GM14547-PA 2..142 1..143 140 30.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:27:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14128-PA 473 GD14128-PA 4..255 1..252 987 92.1 Plus
Dsim\GD12961-PA 153 GD12961-PA 36..149 28..145 154 35 Plus
Dsim\GD12960-PA 160 GD12960-PA 13..154 4..145 144 34 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13074-PA 420 GJ13074-PA 22..246 15..253 359 40.2 Plus
Dvir\GJ13075-PA 245 GJ13075-PA 4..242 6..293 180 27.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16739-PA 488 GK16739-PA 23..276 10..285 507 42.4 Plus
Dwil\GK17468-PA 151 GK17468-PA 12..140 3..136 181 37.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:27:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20779-PA 308 GE20779-PA 4..307 1..296 1002 79.3 Plus
Dyak\GE21281-PA 154 GE21281-PA 37..150 28..145 158 34.2 Plus
Dyak\GE20783-PA 209 GE20783-PA 146..206 229..289 158 44.3 Plus
Dyak\GE21280-PA 160 GE21280-PA 13..154 4..145 148 31.8 Plus

IP11947.hyp Sequence

Translation from 0 to 893

> IP11947.hyp
FMLIVLLSALVAPSIVSAACGQCVDAHSCIGESEFQLCYDGVRDQTINYT
CPESKPICTTYGIICMPNGTSIERGCGDVSNCGVCSESTTFACTSRTTFA
VCNGDVVSANSFDCAEDFVCSVKNAASGSPCISRCDSSDSDICDRVLEPE
VESTTASVTPTVTSTVTPIETTADPSTVITDSSTGSTGDTSTGSSSVTSS
DTSTDSTVTVTDSGSTTQSTATTPAFNEDTYCQEINSTGRYPIPNDTVCT
SYIYCVLRSGSWAGLLYNCNVQRPYFDADVFSCGTVKPSYAGCTNLV*

IP11947.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG34426-PA 296 CG34426-PA 1..296 2..297 1575 100 Plus
CG13312-PA 342 CG13312-PA 14..330 2..294 272 28.1 Plus
CG34427-PB 269 CG34427-PB 12..267 2..290 252 30.2 Plus
CG42525-PB 377 CG42525-PB 152..375 78..289 235 28.4 Plus
CG42525-PA 419 CG42525-PA 194..417 78..289 235 28.4 Plus