Clone IP12060 Report

Search the DGRC for IP12060

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:120
Well:60
Vector:pOT2
Associated Gene/TranscriptCG34442-RA
Protein status:IP12060.pep: gold
Preliminary Size:1428
Sequenced Size:817

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34442 2008-04-29 Release 5.5 accounting
CG34442 2008-08-15 Release 5.9 accounting
CG34442 2008-12-18 5.12 accounting

Clone Sequence Records

IP12060.complete Sequence

817 bp (817 high quality bases) assembled on 2005-08-26

GenBank Submission: BT024306

> IP12060.complete
ATATTATTTACCATTGGATATTTTAGAAATTTATCAATACCATGTACAGA
ACTTTGATATTTGCACCCTTTCTTTTTCTCTGTGCCATAATAAATAACTT
CAATTTGGTTAAGTCTGCGCTGCTTTTCACCACAAACTCCGAGTATGGGA
TATTCATGGCCATATCGGTGCCGATTGGCTTGCCACATCGCAATGTCTTT
CTGTCCTATAACTACGAGTTTAATTACTATCAACCGGAACACGTGTACAA
ATATCCACCGATTTTGATGGGTCAGGACTTTGAGGACAGCTATCTCACAT
ATCCGACAACTGGACGTGAGGCCGAAGGGCGACACTGCCAGAATTGCACA
GATTGGAAAATAGAGGGAAATATAAATAGCACCTCATCAAATAATAACTC
AACTAAAGCTGCTTCGCGCGAAAAACGTGGTCTAACTCTGATGAGTCGCT
CGGTATTTTATGCAATGCTAAGGGATAAATTAAGAAGGTCAGGGTTTCCA
GCTGAACCCTGTTTGCTGCGCTTGATATGCGATACAAATGCTTCACAACT
GGGTGAAGTTAATGGATTTTTAGGCAGCCTCGTTCACATTATATTCAGTC
CCAGCAGTTCCAAGGATGAGCACCTGCCCAATGAGTATTACCAGGCCGAA
TGGGATGGTCGAGAGCAGCAGGAGTGCTCCACGTATACCAAAAGTTGTGA
TCACAACATCTTGGACCTGGTTTCCGTGTCACTGGAACAGTCTTTAAGCG
ATATTGTAAGCCGACGAGGGCGCAAATAAACTGGAGTGTTGACCAAGAAA
AAAAAAAAAAAAAAAAA

IP12060.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG34442-RA 872 CG34442-RA 11..809 1..799 3995 100 Plus
CG34442.a 815 CG34442.a 18..809 1..799 3865 99.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10254529..10254753 266..490 1125 100 Plus
chr2R 21145070 chr2R 10254978..10255178 597..797 1005 100 Plus
chr2R 21145070 chr2R 10254136..10254284 1..149 745 100 Plus
chr2R 21145070 chr2R 10254344..10254467 149..272 605 99.2 Plus
chr2R 21145070 chr2R 10254804..10254916 486..598 565 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:12:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14367225..14367449 266..490 1125 100 Plus
2R 25286936 2R 14367674..14367876 597..799 1015 100 Plus
2R 25286936 2R 14366832..14366980 1..149 745 100 Plus
2R 25286936 2R 14367040..14367163 149..272 605 99.2 Plus
2R 25286936 2R 14367500..14367612 486..598 565 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14368424..14368648 266..490 1125 100 Plus
2R 25260384 2R 14368873..14369075 597..799 1015 100 Plus
2R 25260384 2R 14368031..14368179 1..149 745 100 Plus
2R 25260384 2R 14368239..14368362 149..272 605 99.1 Plus
2R 25260384 2R 14368699..14368811 486..598 565 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:01:48 has no hits.

IP12060.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:02:37 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10254980..10255178 599..797 100   Plus
chr2R 10254136..10254284 1..149 100 -> Plus
chr2R 10254345..10254461 150..266 100 -> Plus
chr2R 10254530..10254750 267..487 100 -> Plus
chr2R 10254806..10254916 488..598 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:51:18 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
CG34442-RA 1..738 42..779 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:50:46 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
CG34442-RA 1..738 42..779 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:52:55 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
CG34442-RA 1..738 42..779 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:32:47 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
CG34442-RA 1..738 42..779 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:52:54 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
CG34442-RA 1..738 42..779 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:26:27 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
CG34442-RA 1..797 1..797 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:50:46 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
CG34442-RA 1..797 1..797 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:52:55 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
CG34442-RA 35..831 1..797 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:32:48 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
CG34442-RA 1..797 1..797 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:52:54 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
CG34442-RA 35..831 1..797 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:02:37 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14367226..14367446 267..487 100 -> Plus
2R 14367502..14367612 488..598 100 -> Plus
2R 14367676..14367874 599..797 100   Plus
2R 14366832..14366980 1..149 100 -> Plus
2R 14367041..14367157 150..266 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:02:37 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14367226..14367446 267..487 100 -> Plus
2R 14367502..14367612 488..598 100 -> Plus
2R 14367676..14367874 599..797 100   Plus
2R 14366832..14366980 1..149 100 -> Plus
2R 14367041..14367157 150..266 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:02:37 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14367226..14367446 267..487 100 -> Plus
2R 14367502..14367612 488..598 100 -> Plus
2R 14367676..14367874 599..797 100   Plus
2R 14366832..14366980 1..149 100 -> Plus
2R 14367041..14367157 150..266 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:52:55 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10255181..10255379 599..797 100   Plus
arm_2R 10254337..10254485 1..149 100 -> Plus
arm_2R 10254546..10254662 150..266 100 -> Plus
arm_2R 10254731..10254951 267..487 100 -> Plus
arm_2R 10255007..10255117 488..598 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:09:58 Download gff for IP12060.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14368425..14368645 267..487 100 -> Plus
2R 14368701..14368811 488..598 100 -> Plus
2R 14368875..14369073 599..797 100   Plus
2R 14368031..14368179 1..149 100 -> Plus
2R 14368240..14368356 150..266 100 -> Plus

IP12060.pep Sequence

Translation from 41 to 778

> IP12060.pep
MYRTLIFAPFLFLCAIINNFNLVKSALLFTTNSEYGIFMAISVPIGLPHR
NVFLSYNYEFNYYQPEHVYKYPPILMGQDFEDSYLTYPTTGREAEGRHCQ
NCTDWKIEGNINSTSSNNNSTKAASREKRGLTLMSRSVFYAMLRDKLRRS
GFPAEPCLLRLICDTNASQLGEVNGFLGSLVHIIFSPSSSKDEHLPNEYY
QAEWDGREQQECSTYTKSCDHNILDLVSVSLEQSLSDIVSRRGRK*

IP12060.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13499-PA 217 GF13499-PA 1..198 39..240 849 77.2 Plus
Dana\GF19838-PA 160 GF19838-PA 1..160 37..245 422 45.7 Plus
Dana\GF10418-PA 217 GF10418-PA 13..217 15..231 210 25.6 Plus
Dana\GF18395-PA 207 GF18395-PA 104..204 136..232 142 33.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20448-PA 397 GG20448-PA 1..164 39..239 727 76.6 Plus
Dere\GG20447-PA 189 GG20447-PA 1..186 39..242 595 57.4 Plus
Dere\GG13784-PA 219 GG13784-PA 25..217 27..229 218 29.8 Plus
Dere\GG18399-PA 216 GG18399-PA 113..213 136..232 142 33.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19744-PA 408 GH19744-PA 1..197 39..231 663 63.3 Plus
Dgri\GH19744-PA 408 GH19744-PA 197..403 37..238 379 40.2 Plus
Dgri\GH14426-PA 208 GH14426-PA 16..208 13..231 223 27.2 Plus
Dgri\GH19313-PA 210 GH19313-PA 111..210 136..231 155 36 Plus
Dgri\GH17146-PA 460 GH17146-PA 132..223 136..224 148 35.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG34442-PA 245 CG34442-PA 1..245 1..245 1300 100 Plus
CG34184-PA 224 CG34184-PA 8..220 14..242 669 56.8 Plus
CG34443-PA 239 CG34443-PA 4..234 4..238 421 41.5 Plus
CG34444-PA 295 CG34444-PA 12..285 16..228 281 28.4 Plus
CG14115-PA 219 CG14115-PA 19..219 21..231 226 29.6 Plus
CG14720-PB 204 CG14720-PB 101..201 136..232 144 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20278-PA 799 GI20278-PA 1..202 39..237 680 63.8 Plus
Dmoj\GI20278-PA 799 GI20278-PA 199..365 76..239 497 57.8 Plus
Dmoj\GI20278-PA 799 GI20278-PA 365..552 37..238 398 44.6 Plus
Dmoj\GI20278-PA 799 GI20278-PA 680..788 123..231 228 40.9 Plus
Dmoj\GI13557-PA 211 GI13557-PA 4..211 1..231 227 27.3 Plus
Dmoj\GI23532-PA 216 GI23532-PA 30..216 17..231 161 26.9 Plus
Dmoj\GI23533-PA 195 GI23533-PA 96..193 136..229 155 37.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10687-PA 397 GL10687-PA 1..168 39..239 574 57.8 Plus
Dper\GL10687-PA 397 GL10687-PA 170..392 17..238 397 38.9 Plus
Dper\GL10688-PA 298 GL10688-PA 182..293 126..237 254 45.1 Plus
Dper\GL24802-PA 218 GL24802-PA 20..215 22..229 243 29.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24447-PA 433 GA24447-PA 2..226 19..239 879 73 Plus
Dpse\GA24447-PA 433 GA24447-PA 226..428 37..238 366 40.2 Plus
Dpse\GA24448-PA 298 GA24448-PA 182..293 126..237 245 44.2 Plus
Dpse\GA12769-PA 218 GA12769-PA 20..215 22..229 244 29.7 Plus
Dpse\GA13202-PA 212 GA13202-PA 109..210 136..232 156 35.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21535-PA 479 GM21535-PA 1..164 39..239 773 75.1 Plus
Dsec\GM19477-PA 187 GM19477-PA 31..186 76..244 420 51.8 Plus
Dsec\GM24610-PA 219 GM24610-PA 17..219 19..231 223 29.3 Plus
Dsec\GM21535-PA 479 GM21535-PA 164..299 37..206 148 32 Plus
Dsec\GM23974-PA 204 GM23974-PA 101..201 136..232 141 32.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11043-PA 196 GD11043-PA 1..195 37..244 612 58.4 Plus
Dsim\GD11044-PA 121 GD11044-PA 1..112 39..150 572 93.8 Plus
Dsim\GD12676-PA 221 GD12676-PA 17..221 19..231 217 28.8 Plus
Dsim\GD18779-PA 204 GD18779-PA 101..201 136..232 140 32.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:06:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22006-PA 369 GJ22006-PA 1..164 39..239 458 48.3 Plus
Dvir\GJ22006-PA 369 GJ22006-PA 164..364 37..238 394 44 Plus
Dvir\GJ22007-PA 262 GJ22007-PA 1..250 6..231 316 32.3 Plus
Dvir\GJ11918-PA 215 GJ11918-PA 19..215 16..231 226 27.9 Plus
Dvir\GJ10282-PA 261 GJ10282-PA 150..261 124..231 161 34.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:06:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21474-PA 413 GK21474-PA 1..199 39..233 677 65.7 Plus
Dwil\GK21474-PA 413 GK21474-PA 192..408 28..238 377 40 Plus
Dwil\GK16780-PA 214 GK16780-PA 15..214 20..231 229 26.5 Plus
Dwil\GK11101-PA 126 GK11101-PA 23..123 136..232 167 34.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:06:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13579-PA 366 GE13579-PA 1..164 39..239 732 75.6 Plus
Dyak\GE18111-PA 195 GE18111-PA 1..195 37..245 598 56.2 Plus
Dyak\GE20078-PA 219 GE20078-PA 25..219 27..231 215 29.5 Plus
Dyak\GE13579-PA 366 GE13579-PA 164..312 37..219 161 31.1 Plus
Dyak\GE24198-PA 210 GE24198-PA 107..207 136..232 142 32.7 Plus

IP12060.hyp Sequence

Translation from 41 to 778

> IP12060.hyp
MYRTLIFAPFLFLCAIINNFNLVKSALLFTTNSEYGIFMAISVPIGLPHR
NVFLSYNYEFNYYQPEHVYKYPPILMGQDFEDSYLTYPTTGREAEGRHCQ
NCTDWKIEGNINSTSSNNNSTKAASREKRGLTLMSRSVFYAMLRDKLRRS
GFPAEPCLLRLICDTNASQLGEVNGFLGSLVHIIFSPSSSKDEHLPNEYY
QAEWDGREQQECSTYTKSCDHNILDLVSVSLEQSLSDIVSRRGRK*

IP12060.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG34442-PA 245 CG34442-PA 1..245 1..245 1300 100 Plus
CG34184-PA 224 CG34184-PA 8..220 14..242 669 56.8 Plus
CG34443-PA 239 CG34443-PA 4..234 4..238 421 41.5 Plus
CG34444-PA 295 CG34444-PA 12..285 16..228 281 28.4 Plus
CG14115-PA 219 CG14115-PA 19..219 21..231 226 29.6 Plus