Clone IP12083 Report

Search the DGRC for IP12083

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:120
Well:83
Vector:pOT2
Associated Gene/Transcriptppk22-RC
Protein status:IP12083.pep: gold
Preliminary Size:1629
Sequenced Size:483

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31105 2008-04-29 Release 5.5 accounting
CG31105 2008-08-15 Release 5.9 accounting
CG31105 2008-12-18 5.12 accounting

Clone Sequence Records

IP12083.complete Sequence

483 bp (483 high quality bases) assembled on 2006-01-20

GenBank Submission: BT024303

> IP12083.complete
GAGTAAATAAAGACCTCAGAAATATGGTCAAGCTGGCATCAACATCCAAT
GCCATTTGGTGGATTAAGAATCCCAAGGCAGCCGGGGAACATAATTCCAA
AGGTAAACGCAAGGAGTCCTTGGGCTCAGCCTTCTGCTTGGATATGGCGG
ATCTGGTTAGAAACATATCCCTACAGGGTTACAATAAGCTTTTGTCACCG
GACTTGACCTTGGGACAAAGATTGATTTGGTTGCTGGTACACATGGCCAC
CACCGTCTCCCTGATTGTGGTGCTCTCGCTAACATGGGAGCAGTTCGTGG
CCCAATCCTTTGTGACCAATCTGAAGGATCCTCTTTTTCCAGTGGAGAAT
GTGCCATTCCCGGCTGTTTCCATCTGCCCCAACAATCGCATCTCTCGCCA
GGCAGTTATCCAATATGCTGAAGAATTGTGAGGCTAAAATTATTGAAATA
AATATTTGTGTACTTAAAAAAAAAAAAAAAAAA

IP12083.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG31105-RB 1776 CG31105-RB 68..495 1..428 2140 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20682392..20682638 465..219 1235 100 Minus
chr3R 27901430 chr3R 20682701..20682920 220..1 1100 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:12:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24859203..24859452 468..219 1250 100 Minus
3R 32079331 3R 24859515..24859734 220..1 1100 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24600034..24600283 468..219 1250 100 Minus
3R 31820162 3R 24600346..24600565 220..1 1100 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:04:45 has no hits.

IP12083.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:05:44 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20682392..20682636 221..465 100 <- Minus
chr3R 20682701..20682920 1..220 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:51:20 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31105-RB 1..413 24..438 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:05:18 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31105-RB 1..413 24..438 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:01:27 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31105-RC 1..408 24..431 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:09:09 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31105-RB 1..413 24..438 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:21:54 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
ppk22-RC 1..408 24..431 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:30:57 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31105-RB 1..436 1..438 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:05:18 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31105-RB 633..1068 1..438 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:01:27 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31105-RC 1..465 1..465 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:54 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31105-RB 1..436 1..438 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:21:54 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
ppk22-RC 68..532 1..465 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:44 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24859206..24859450 221..465 100 <- Minus
3R 24859515..24859734 1..220 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:44 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24859206..24859450 221..465 100 <- Minus
3R 24859515..24859734 1..220 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:44 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24859206..24859450 221..465 100 <- Minus
3R 24859515..24859734 1..220 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:01:27 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20684928..20685172 221..465 100 <- Minus
arm_3R 20685237..20685456 1..220 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:39:01 Download gff for IP12083.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24600037..24600281 221..465 100 <- Minus
3R 24600346..24600565 1..220 100   Minus

IP12083.pep Sequence

Translation from 2 to 430

> IP12083.pep
VNKDLRNMVKLASTSNAIWWIKNPKAAGEHNSKGKRKESLGSAFCLDMAD
LVRNISLQGYNKLLSPDLTLGQRLIWLLVHMATTVSLIVVLSLTWEQFVA
QSFVTNLKDPLFPVENVPFPAVSICPNNRISRQAVIQYAEEL*

IP12083.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18007-PA 559 GF18007-PA 1..135 8..142 582 80 Plus
Dana\GF17779-PA 618 GF17779-PA 13..157 9..142 198 32 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12311-PA 561 GG12311-PA 1..135 8..142 631 91.9 Plus
Dere\GG11801-PA 575 GG11801-PA 16..154 13..142 185 28.2 Plus
Dere\GG24007-PA 531 GG24007-PA 48..150 40..142 158 30.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16423-PA 563 GH16423-PA 1..145 8..142 471 64.8 Plus
Dgri\GH16433-PA 584 GH16433-PA 10..144 6..142 213 32.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
ppk22-PC 135 CG31105-PC 1..135 8..142 693 100 Plus
ppk22-PB 561 CG31105-PB 1..135 8..142 693 100 Plus
ppk24-PA 595 CG15555-PA 16..154 13..142 185 28.9 Plus
ppk16-PA 531 CG34059-PA 10..150 4..142 157 27 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:52:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22199-PA 537 GI22199-PA 1..134 8..142 473 67.4 Plus
Dmoj\GI22200-PA 502 GI22200-PA 21..152 16..142 214 33.8 Plus
Dmoj\GI18204-PA 536 GI18204-PA 54..152 44..142 151 30.3 Plus
Dmoj\GI12811-PA 433 GI12811-PA 4..107 40..142 143 34.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:52:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13559-PA 548 GL13559-PA 1..138 8..142 570 78.3 Plus
Dper\GL13740-PA 619 GL13740-PA 62..160 44..142 187 36.4 Plus
Dper\GL19209-PA 529 GL19209-PA 31..148 25..142 171 28.8 Plus
Dper\GL13896-PA 636 GL13896-PA 54..129 56..131 143 36.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16013-PA 563 GA16013-PA 1..138 8..142 569 77.5 Plus
Dpse\GA27013-PA 618 GA27013-PA 62..160 44..142 190 37.4 Plus
Dpse\GA25877-PA 529 GA25877-PA 31..148 25..142 171 28.8 Plus
Dpse\GA11359-PA 553 GA11359-PA 54..129 56..131 143 36.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23453-PA 542 GM23453-PA 1..135 8..142 685 95.6 Plus
Dsec\GM12934-PA 597 GM12934-PA 12..150 13..142 189 28.8 Plus
Dsec\GM12265-PA 531 GM12265-PA 10..150 4..142 154 26.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18259-PA 542 GD18259-PA 1..135 8..142 690 96.3 Plus
Dsim\GD21571-PA 603 GD21571-PA 12..150 13..142 189 28.8 Plus
Dsim\GD22336-PA 531 GD22336-PA 10..150 4..142 157 26.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24318-PA 557 GJ24318-PA 1..134 8..142 467 68.9 Plus
Dvir\GJ24319-PA 611 GJ24319-PA 21..151 17..142 211 34.1 Plus
Dvir\GJ12955-PA 435 GJ12955-PA 4..106 40..142 144 33 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22757-PA 570 GK22757-PA 1..141 8..142 502 69.5 Plus
Dwil\GK22758-PA 600 GK22758-PA 47..145 43..142 202 38.2 Plus
Dwil\GK11905-PA 552 GK11905-PA 36..131 36..131 151 34.4 Plus
Dwil\GK24818-PA 534 GK24818-PA 10..143 4..132 140 28.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10766-PA 546 GE10766-PA 1..135 8..142 674 94.1 Plus
Dyak\GE10931-PA 614 GE10931-PA 18..154 15..142 185 32.6 Plus
Dyak\GE10325-PA 532 GE10325-PA 10..150 4..142 171 28.4 Plus

IP12083.hyp Sequence

Translation from 2 to 430

> IP12083.hyp
VNKDLRNMVKLASTSNAIWWIKNPKAAGEHNSKGKRKESLGSAFCLDMAD
LVRNISLQGYNKLLSPDLTLGQRLIWLLVHMATTVSLIVVLSLTWEQFVA
QSFVTNLKDPLFPVENVPFPAVSICPNNRISRQAVIQYAEEL*

IP12083.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
ppk22-PC 135 CG31105-PC 1..135 8..142 693 100 Plus
ppk22-PB 561 CG31105-PB 1..135 8..142 693 100 Plus
ppk24-PA 595 CG15555-PA 16..154 13..142 185 28.9 Plus
ppk16-PA 531 CG34059-PA 10..150 4..142 157 27 Plus