Clone IP12118 Report

Search the DGRC for IP12118

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:121
Well:18
Vector:pOT2
Associated Gene/TranscriptCG15639
Protein status:IP12118.pep: Imported from assembly
Preliminary Size:1590
Sequenced Size:849

Clone Sequence Records

IP12118.complete Sequence

849 bp assembled on 2009-07-10

GenBank Submission: BT088918.1

> IP12118.complete
AATGATCAGCCAGTCGATGGCGTCGTGCGCCTTCGTCTCAAGGTGGCCCA
GTGGATCTACGGCATTGCGGCGCTGTTCATTGTCCTGGCCATTGGGCTGC
TCATCTTGCCGGGCCTGTTCAGACGATACCTCCTGGTTCCGGATGTAGTG
GCTACCTATTGCTTCTTTGTCATCGGATTGGTCACCCTGTGCGTCTATGT
CAACGTCACTTGGCTGCGCCGGAAGTTCCCCTTCAACTGGATAGTCAGCT
GCTGCATAGCAGCCTGTCTGGCACTGGGAACGGTGTGTATCCTTTCAAAC
CAGCGGACGGGACACGTCCTGCTGCTGAGCATGGAGATTCTTGTCATGAT
GGCGCTGCTCCTGCTGGTCGGCTCATATCTATTGCCCGAATGCCCTGCAA
TGGCCTACTTGTTCCTCACTTGGTTCATATTCGTTGTGCTCTCCTCCGTC
CTAATGGCCGCCGTTTGTGTACACGTTTCAGATCAGATATTCTCCTATGA
AGTAGCCACCCACTTTGTGCTCTGGCAAGTTATATGCCCATTGATTGTGT
TCCAGGCGCAGGTCATATCCGGCTATTGGGAGAATTTACCGCCAATTCTG
GATAGGCCGCTGTGCTCCACGATGCTCCTGTTCGACTTTCTCGCCTGCTA
CATCTTTCTTGACTCCGCCAATGACGTTGGTTTTGAGTTCTACTACGCTG
GCCAGACGGCAAATCAAAAGTTTTTGTCCAGATCCGTTAAGAGCCAGTGG
GAGATGTTCATGGATTAGGGATTTCCTAAATTGGACACCTGTGAAAAAGC
CTCCCCTGCAGGGCCAAATATATGAATAGAACGAAAAAAAAAAAAAAAA

IP12118.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG15639-RB 836 CG15639-RB 4..836 1..833 4165 100 Plus
CG15639.b 1932 CG15639.b 4..682 1..679 3395 100 Plus
CG15639-RA 1590 CG15639-RA 4..682 1..679 3395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13304590..13305422 833..1 4165 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:13:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13305918..13306752 835..1 4175 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13305918..13306752 835..1 4175 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:51:16 has no hits.

IP12118.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:52:15 Download gff for IP12118.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13304590..13305422 1..833 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:50:01 Download gff for IP12118.complete
Subject Subject Range Query Range Percent Splice Strand
CG15639-RA 4..682 1..679 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:51:15 Download gff for IP12118.complete
Subject Subject Range Query Range Percent Splice Strand
CG15639-RB 4..771 1..768 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:26:35 Download gff for IP12118.complete
Subject Subject Range Query Range Percent Splice Strand
CG43779-RA 4..771 1..768 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:33:21 Download gff for IP12118.complete
Subject Subject Range Query Range Percent Splice Strand
CG43779-RA 4..771 1..768 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-10 10:24:49 Download gff for IP12118.complete
Subject Subject Range Query Range Percent Splice Strand
CG15639-RA 4..682 1..679 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:51:15 Download gff for IP12118.complete
Subject Subject Range Query Range Percent Splice Strand
CG15639-RB 4..836 1..833 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:26:35 Download gff for IP12118.complete
Subject Subject Range Query Range Percent Splice Strand
CG16825-RA 1..833 1..833 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:33:21 Download gff for IP12118.complete
Subject Subject Range Query Range Percent Splice Strand
CG16825-RA 1..833 1..833 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:52:15 Download gff for IP12118.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13305920..13306752 1..833 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:52:15 Download gff for IP12118.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13305920..13306752 1..833 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:52:15 Download gff for IP12118.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13305920..13306752 1..833 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:26:35 Download gff for IP12118.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13305920..13306752 1..833 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:27:18 Download gff for IP12118.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13305920..13306752 1..833 100   Minus

IP12118.pep Sequence

Translation from 0 to 767

> IP12118.pep
NDQPVDGVVRLRLKVAQWIYGIAALFIVLAIGLLILPGLFRRYLLVPDVV
ATYCFFVIGLVTLCVYVNVTWLRRKFPFNWIVSCCIAACLALGTVCILSN
QRTGHVLLLSMEILVMMALLLLVGSYLLPECPAMAYLFLTWFIFVVLSSV
LMAAVCVHVSDQIFSYEVATHFVLWQVICPLIVFQAQVISGYWENLPPIL
DRPLCSTMLLFDFLACYIFLDSANDVGFEFYYAGQTANQKFLSRSVKSQW
EMFMD*

IP12118.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21675-PA 518 GF21675-PA 2..227 1..226 516 51.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10212-PA 528 GG10212-PA 2..227 1..226 912 83.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25110-PA 254 GH25110-PA 19..251 19..251 351 37.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG43779-PA 256 CG43779-PA 2..256 1..255 1337 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:24:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14090-PA 246 GI14090-PA 2..245 1..247 268 32.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:24:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25615-PA 252 GL25615-PA 13..250 12..248 409 42.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13865-PA 548 GA13865-PA 10..228 7..226 411 45.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25663-PA 258 GM25663-PA 2..256 1..255 1198 94.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22072-PA 258 GD22072-PA 2..256 1..255 1204 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18269-PA 510 GJ18269-PA 19..219 19..220 333 39.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15293-PA 525 GK15293-PA 23..232 19..226 303 39.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11743-PA 526 GE11743-PA 2..227 1..226 954 87.6 Plus

IP12118.hyp Sequence

Translation from 0 to 767

> IP12118.hyp
NDQPVDGVVRLRLKVAQWIYGIAALFIVLAIGLLILPGLFRRYLLVPDVV
ATYCFFVIGLVTLCVYVNVTWLRRKFPFNWIVSCCIAACLALGTVCILSN
QRTGHVLLLSMEILVMMALLLLVGSYLLPECPAMAYLFLTWFIFVVLSSV
LMAAVCVHVSDQIFSYEVATHFVLWQVICPLIVFQAQVISGYWENLPPIL
DRPLCSTMLLFDFLACYIFLDSANDVGFEFYYAGQTANQKFLSRSVKSQW
EMFMD*

IP12118.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG43779-PA 256 CG43779-PA 2..256 1..255 1337 100 Plus