Clone IP12216 Report

Search the DGRC for IP12216

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:122
Well:16
Vector:pOT2
Associated Gene/TranscriptCG34432-RA
Protein status:IP12216.pep: gold
Preliminary Size:1389
Sequenced Size:750

Clone Sequence Records

IP12216.complete Sequence

750 bp assembled on 2009-04-30

GenBank Submission: BT082104.1

> IP12216.complete
CACAAAATTCAATTCAATCAACATGAATAAACTATATTTGTATTCCACCG
CCGATTTACTGCTCATCCAACCTGGAGCAGTACGTCCGGCGCTCTTCCTA
TTCTACACCTTGGAGACGATTTTAAACATGATCTGCATTGGATATCACAT
CACCGGATTCCAGCCCCTCGAGTGGAAAGGGCAGGAGGTCCACTACCTGT
GCCTGCTTATCTTTAACGTCTTCATGGTGATGAACTTCTTCCAGAGCATC
GCGATTTGCACGGGACGCGTGCCCAATGTCTTGATGGAGATATGGAAAGC
ATCGGTGGCAGCCTTCGCTTTCATCCTGATATCCTTTCTCACCATGTGGG
ACGTGGAGCAGCAGTTCTCTGTGTTCTTCGTGAGATCTAGCGAGCAGGTC
CGGGGCGAGCACAAAGAACTGCCTCCCGTTCACCCGATCATCCGGTACAA
GACGGGTCAGTCCATTTGCTCGCTGTTTTGTGGACTAATCTACATGCTCC
ACGCCGTAATAATGTTCGACGTCAGGCTGACCTCCAAGCTTATTGTCAGT
GGATCACGGCACTTGCCCATTCCCCTCTTTGTCCTGGGTCGCGCTTTTCA
TAGAAAGATTTATGCCTACGAATGGTTCAAGGAGTTTTGCGGGAATAATA
CCATTGAAGTCTAGTAGATCCTTTTTTTTCGGCCTAGATCATAAATCCTT
TTTTCGGCTAAAATATATGTACATAAATGCAAACAAAAAAAAAAAAAAAA

IP12216.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG34432-RA 732 CG34432-RA 1..730 1..731 3615 99.8 Plus
CG34433-RA 702 CG34433-RA 312..404 286..378 195 80.6 Plus
CG34433.a 824 CG34433.a 290..382 286..378 195 80.6 Plus
CG34433-RA 702 CG34433-RA 102..182 91..171 165 80.2 Plus
CG34433.a 824 CG34433.a 143..223 91..171 165 80.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26471684..26472413 1..731 3575 99.6 Plus
chr3R 27901430 chr3R 26472818..26472910 286..378 195 80.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:13:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30649145..30649874 1..731 3605 99.9 Plus
3R 32079331 3R 30650279..30650371 286..378 195 80.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30389976..30390705 1..731 3615 99.8 Plus
3R 31820162 3R 30391110..30391202 286..378 195 80.6 Plus
3R 31820162 3R 30390900..30390980 91..171 165 80.2 Plus
Blast to na_te.dros performed on 2019-03-16 07:48:25 has no hits.

IP12216.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:49:15 Download gff for IP12216.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26471684..26472415 1..734 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:51:40 Download gff for IP12216.complete
Subject Subject Range Query Range Percent Splice Strand
CG34432-RA 1..642 23..664 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:49:46 Download gff for IP12216.complete
Subject Subject Range Query Range Percent Splice Strand
CG34432-RA 1..642 23..664 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:50:46 Download gff for IP12216.complete
Subject Subject Range Query Range Percent Splice Strand
CG34432-RA 1..642 23..664 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:39:49 Download gff for IP12216.complete
Subject Subject Range Query Range Percent Splice Strand
CG34432-RA 1..642 23..664 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-30 18:56:11 Download gff for IP12216.complete
Subject Subject Range Query Range Percent Splice Strand
CG34432-RA 1..726 7..733 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:49:46 Download gff for IP12216.complete
Subject Subject Range Query Range Percent Splice Strand
CG34432-RA 1..723 7..730 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:50:46 Download gff for IP12216.complete
Subject Subject Range Query Range Percent Splice Strand
CG34432-RA 1..723 7..730 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:39:49 Download gff for IP12216.complete
Subject Subject Range Query Range Percent Splice Strand
CG34432-RA 1..723 7..730 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:15 Download gff for IP12216.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30649145..30649876 1..734 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:15 Download gff for IP12216.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30649145..30649876 1..734 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:15 Download gff for IP12216.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30649145..30649876 1..734 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:50:46 Download gff for IP12216.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26474867..26475598 1..734 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:40:39 Download gff for IP12216.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30389976..30390707 1..734 99   Plus

IP12216.hyp Sequence

Translation from 0 to 663

> IP12216.hyp
TKFNSINMNKLYLYSTADLLLIQPGAVRPALFLFYTLETILNMICIGYHI
TGFQPLEWKGQEVHYLCLLIFNVFMVMNFFQSIAICTGRVPNVLMEIWKA
SVAAFAFILISFLTMWDVEQQFSVFFVRSSEQVRGEHKELPPVHPIIRYK
TGQSICSLFCGLIYMLHAVIMFDVRLTSKLIVSGSRHLPIPLFVLGRAFH
RKIYAYEWFKEFCGNNTIEV*

IP12216.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34432-PA 213 CG34432-PA 1..213 8..220 1125 100 Plus
CG34433-PA 233 CG34433-PA 27..231 23..218 561 54.1 Plus
CG34433-PB 212 CG34433-PB 27..210 23..218 499 51.5 Plus
CG14315-PA 217 CG14315-PA 8..217 27..220 220 24.9 Plus

IP12216.pep Sequence

Translation from 1 to 663

> IP12216.pep
TKFNSINMNKLYLYSTADLLLIQPGAVRPALFLFYTLETILNMICIGYHI
TGFQPLEWKGQEVHYLCLLIFNVFMVMNFFQSIAICTGRVPNVLMEIWKA
SVAAFAFILISFLTMWDVEQQFSVFFVRSSEQVRGEHKELPPVHPIIRYK
TGQSICSLFCGLIYMLHAVIMFDVRLTSKLIVSGSRHLPIPLFVLGRAFH
RKIYAYEWFKEFCGNNTIEV*

IP12216.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 15:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16758-PA 218 GF16758-PA 8..218 27..220 270 30.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 15:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11769-PA 359 GG11769-PA 1..148 8..155 636 78.4 Plus
Dere\GG11769-PA 359 GG11769-PA 153..357 23..218 533 52.2 Plus
Dere\GG22659-PA 217 GG22659-PA 8..217 27..220 199 23.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 15:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15090-PA 207 GH15090-PA 1..200 27..213 266 31.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG34432-PA 213 CG34432-PA 1..213 8..220 1125 100 Plus
CG34433-PA 233 CG34433-PA 27..231 23..218 561 54.1 Plus
CG34433-PB 212 CG34433-PB 27..210 23..218 499 51.5 Plus
CG14315-PA 217 CG14315-PA 8..217 27..220 220 24.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 15:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22116-PA 223 GI22116-PA 22..223 27..220 434 44.8 Plus
Dmoj\GI23715-PA 204 GI23715-PA 1..204 27..220 258 31.7 Plus
Dmoj\GI23716-PA 203 GI23716-PA 1..195 27..212 195 28 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 15:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13511-PA 163 GL13511-PA 13..158 25..164 346 47.3 Plus
Dper\GL12591-PA 211 GL12591-PA 1..211 27..220 296 31.2 Plus
Dper\GL12590-PA 207 GL12590-PA 2..207 27..220 275 31 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 15:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26877-PA 218 GA26877-PA 10..218 22..220 482 46.9 Plus
Dpse\GA12902-PA 211 GA12902-PA 1..211 27..220 301 31.2 Plus
Dpse\GA27567-PA 207 GA27567-PA 2..207 27..220 277 31 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 15:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12899-PA 381 GM12899-PA 1..148 8..155 753 95.3 Plus
Dsec\GM12899-PA 381 GM12899-PA 153..329 23..192 452 51.4 Plus
Dsec\GM15279-PA 217 GM15279-PA 8..217 27..220 240 26.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 15:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21538-PA 359 GD21538-PA 1..148 8..155 758 95.9 Plus
Dsim\GD21538-PA 359 GD21538-PA 153..357 23..218 549 53.7 Plus
Dsim\GD19203-PA 217 GD19203-PA 8..217 27..220 243 27.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 15:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24236-PA 221 GJ24236-PA 15..221 22..220 456 43.3 Plus
Dvir\GJ24238-PA 209 GJ24238-PA 3..209 22..220 440 42.8 Plus
Dvir\GJ23274-PA 208 GJ23274-PA 1..200 27..212 277 33.3 Plus
Dvir\GJ24234-PA 109 GJ24234-PA 1..109 115..220 199 36.4 Plus
Dvir\GJ24235-PA 109 GJ24235-PA 1..109 115..220 192 35.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 15:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14150-PA 228 GK14150-PA 24..228 25..220 478 45.1 Plus
Dwil\GK18883-PA 209 GK18883-PA 1..209 27..220 347 33.8 Plus
Dwil\GK19182-PA 211 GK19182-PA 1..211 22..220 332 34.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 15:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10896-PA 399 GE10896-PA 1..148 8..154 617 75.7 Plus
Dyak\GE10896-PA 399 GE10896-PA 154..317 23..179 435 52.4 Plus
Dyak\GE25513-PA 217 GE25513-PA 8..217 27..220 207 25.2 Plus