Clone IP12332 Report

Search the DGRC for IP12332

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:123
Well:32
Vector:pOT2
Associated Gene/TranscriptCG17141-RA
Protein status:IP12332.pep: gold
Preliminary Size:1401
Sequenced Size:1080

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17141 2005-01-01 Successful iPCR screen
CG17141 2008-04-29 Release 5.5 accounting
CG17141 2008-08-15 Release 5.9 accounting
CG17141 2008-12-18 5.12 accounting

Clone Sequence Records

IP12332.complete Sequence

1080 bp (1080 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022736

> IP12332.complete
GATTCGCTAGCATTACATGGATTCCGCATCATGGCAGCGCAGCTGAATCC
ATTCCGCAATGCCTTCCGGCTGCCGTCCAAGCAGCGCATCAACTGGTTTC
CCGGCCACATGACCAAGGGTATGCGGCAAATTCAGCAAAAACTACGAAAT
GTAGACTGCATAGTCGAGATTCACGATGCACGCATCCCATTGGCGGGCAG
AAACTCCCAGTTCTTTGACACAATCACCGGAAGTGGTGTTAAACCGCATA
TTCTGGTGCTGAACAAAGTCGATCTGCTGGGCGCCAAACAGCAGAAGAGC
GTGCTCCAGCAGCTGAGGAGACAGCAGCCCGAACTGCAGCACATCCTGTT
CACCAACTGCAAGGATCAGCGCAACAACGGCGTGCTGGACATCCTGCCCC
TGGCAACGCGCCTCGTGAGCGAGAGCAGTCGCTTCAATCGCACCCAAGCT
GCCGAGCACAATCTGATGATCATCGGCGTGCCCAATGTGGGCAAGAGTTC
CGTGATCAATGTGCTGCGAAATGTGCATCTCAAGAAGAAGAGCGCCGCAC
GCGTGGGTGCCGAGGCGGGTATAACTCGATCCGTCGGCGAACGCATCAAA
ATCCAAGAGAATCCGCCTGTTTACATGATCGACACACCCGGCATCCTCCA
GCCCTCCATTAAGGATGATGAAATGGGCATGAAACTGGCCCTGGTGGGCT
GCCTTCCCGATCATATTGTGGGCGAGGATCTGATAGCCGACTATCTGCTG
TACTGGCTGAATAGCCACCGCAAATACGACTACGTGGAGATGCTAAAGCT
CAGCTCCGGACCCAGTGACGACATCAGCGCCGTGCTGGCGGAGTACGCTC
ATCGGGAGGAGCTATTCCACAAGGTCAAGCAGTACGACGGACGCGTGGAG
GTGATGACAAATTTATTGGCGGCCGCGCGAAAGTTCATTCACTTCTTTCG
CTCCGGCCAGTTGGGTCACATGAATCTGGACGAACCCAGTGGTTTCAGAT
AGCTATACATATGTATGAATTAAACTTAGGGGCTTAGATTAAAGACTGAA
CAGTCGAAAAAAAAAAAAAAAAAAAAAAAA

IP12332.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG17141-RA 1102 CG17141-RA 43..1099 1..1057 5285 100 Plus
HP1c.a 888 HP1c.a 728..888 1057..897 805 100 Minus
HP1c-RA 978 HP1c-RA 818..978 1057..897 805 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:11:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18569921..18570748 1056..229 4080 99.5 Minus
chr3R 27901430 chr3R 18570806..18571035 230..1 1150 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:13:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22746445..22747273 1057..229 4145 100 Minus
3R 32079331 3R 22747327..22747556 230..1 1150 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22487276..22488104 1057..229 4145 100 Minus
3R 31820162 3R 22488158..22488387 230..1 1150 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:11:24 has no hits.

IP12332.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:12:31 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18569921..18570747 230..1056 99 <- Minus
chr3R 18570807..18571035 1..229 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:51:51 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
CG17141-RA 1..972 31..1002 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:16:50 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
CG17141-RA 1..972 31..1002 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:45:17 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
CG17141-RA 1..972 31..1002 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:01:12 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
CG17141-RA 1..972 31..1002 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:13:00 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
CG17141-RA 1..972 31..1002 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:16:09 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
CG17141-RA 1..1056 1..1056 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:16:50 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
CG17141-RA 1..1056 1..1056 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:45:17 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
CG17141-RA 44..1099 1..1056 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:01:13 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
CG17141-RA 1..1056 1..1056 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:13:00 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
CG17141-RA 44..1099 1..1056 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:31 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22746446..22747272 230..1056 100 <- Minus
3R 22747328..22747556 1..229 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:31 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22746446..22747272 230..1056 100 <- Minus
3R 22747328..22747556 1..229 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:31 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22746446..22747272 230..1056 100 <- Minus
3R 22747328..22747556 1..229 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:45:17 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18572168..18572994 230..1056 100 <- Minus
arm_3R 18573050..18573278 1..229 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:36:54 Download gff for IP12332.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22488159..22488387 1..229 100   Minus
3R 22487277..22488103 230..1056 100 <- Minus

IP12332.hyp Sequence

Translation from 0 to 1001

> IP12332.hyp
DSLALHGFRIMAAQLNPFRNAFRLPSKQRINWFPGHMTKGMRQIQQKLRN
VDCIVEIHDARIPLAGRNSQFFDTITGSGVKPHILVLNKVDLLGAKQQKS
VLQQLRRQQPELQHILFTNCKDQRNNGVLDILPLATRLVSESSRFNRTQA
AEHNLMIIGVPNVGKSSVINVLRNVHLKKKSAARVGAEAGITRSVGERIK
IQENPPVYMIDTPGILQPSIKDDEMGMKLALVGCLPDHIVGEDLIADYLL
YWLNSHRKYDYVEMLKLSSGPSDDISAVLAEYAHREELFHKVKQYDGRVE
VMTNLLAAARKFIHFFRSGQLGHMNLDEPSGFR*

IP12332.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG17141-PA 323 CG17141-PA 1..323 11..333 1667 100 Plus

IP12332.pep Sequence

Translation from 30 to 1001

> IP12332.pep
MAAQLNPFRNAFRLPSKQRINWFPGHMTKGMRQIQQKLRNVDCIVEIHDA
RIPLAGRNSQFFDTITGSGVKPHILVLNKVDLLGAKQQKSVLQQLRRQQP
ELQHILFTNCKDQRNNGVLDILPLATRLVSESSRFNRTQAAEHNLMIIGV
PNVGKSSVINVLRNVHLKKKSAARVGAEAGITRSVGERIKIQENPPVYMI
DTPGILQPSIKDDEMGMKLALVGCLPDHIVGEDLIADYLLYWLNSHRKYD
YVEMLKLSSGPSDDISAVLAEYAHREELFHKVKQYDGRVEVMTNLLAAAR
KFIHFFRSGQLGHMNLDEPSGFR*

IP12332.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:18:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18288-PA 322 GF18288-PA 1..322 1..323 1583 90.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12486-PA 323 GG12486-PA 1..323 1..323 1675 96.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18661-PA 325 GH18661-PA 1..318 1..317 1471 84.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG17141-PA 323 CG17141-PA 1..323 1..323 1667 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24346-PA 321 GI24346-PA 5..318 6..318 1459 84.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23776-PA 62 GL23776-PA 1..62 1..62 324 93.5 Plus
Dper\GL20652-PA 65 GL20652-PA 1..58 146..203 267 87.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14342-PA 320 GA14342-PA 1..318 1..318 1517 87.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23617-PA 323 GM23617-PA 1..323 1..323 1706 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18426-PA 323 GD18426-PA 1..323 1..323 1716 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24357-PA 324 GJ24357-PA 5..322 6..322 1449 82.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11624-PA 323 GK11624-PA 3..320 2..319 1468 84 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24007-PA 323 GE24007-PA 1..323 1..323 1670 96.3 Plus