Clone IP12368 Report

Search the DGRC for IP12368

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:123
Well:68
Vector:pOT2
Associated Gene/TranscriptCG30259-RB
Protein status:IP12368.pep: wuzgold
Preliminary Size:1395
Sequenced Size:677

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30259 2008-04-29 Release 5.5 accounting
CG30259 2008-08-15 Release 5.9 accounting
CG30259 2008-12-18 5.12 accounting

Clone Sequence Records

IP12368.complete Sequence

677 bp (677 high quality bases) assembled on 2006-04-14

GenBank Submission: BT025095

> IP12368.complete
AAATTTGATAAGCTGATTTTTGGTAGCCGTAAAAAAAAAAAACTAAATCA
TGGGCAAAAAGGGTAAAGGAAAAGGCAACAAATTGGCCAACATGTCCGAG
GAGGAGCGGGCCAGGTATTTGCAAATGAGGGCCGACATGGAGGAAGAGAC
GAGGCGGCGGAAAATGCAGCTCATTTCCATGTACATGAAGAACAAACTGA
AAAGAGAGGATGCTTTTGGTCGACTCAATATGGCTAAAATCAACCAGGAG
TGGCGGAGCATTTTGCGCCAGGTGAAAATCCAGGAGCTGCGCCGCGAAAT
CGTCGATGTGGAGTCTTTCTTTCAGGAGGCACTTAAGCGCAAGGACCAGG
TGATCCATCGCCTCATTGCTCACATAGAATCCACCGAGGATATGTACGCC
AATCTGCAGCAGTCACACATGGAGAATATCACCAGGATAGTTGGTACGAT
TGGGATAACATCCTTAAAAATAACATTTTAATCAGAAACTAAATACACAG
CTACAGCAATATGTTTAAAGATACTTAAAATGAATGGAATGGATTTCACA
TGTATATTAATGCTTTCGTTAATAAGAACATTGAAATATTTGGAAATCCA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAA

IP12368.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG30259-RB 601 CG30259-RB 1..601 1..601 3005 100 Plus
CG30259-RA 1884 CG30259-RA 99..545 1..447 2220 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18590270..18590675 599..189 1810 96.6 Minus
chr2R 21145070 chr2R 18590744..18590933 190..1 920 98.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:14:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22703774..22704189 604..189 2080 100 Minus
2R 25286936 2R 22704258..22704447 190..1 950 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22704973..22705388 604..189 2080 100 Minus
2R 25260384 2R 22705457..22705646 190..1 950 100 Minus
Blast to na_te.dros performed 2019-03-15 15:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
Tc1 1666 Tc1 TC1 1666bp 1348..1432 531..448 133 66.3 Minus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 7374..7435 29..87 132 71 Plus

IP12368.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:26:28 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18590270..18590673 191..599 96 <- Minus
chr2R 18590744..18590933 1..190 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:52:12 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
CG30259-RB 1..432 50..481 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:50:31 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
CG30259-RB 1..432 50..481 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:28:22 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
CG30259-RA 1..408 50..456 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:31:14 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
CG30259-RB 1..432 50..481 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:06:14 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
CG30259-RA 1..408 50..456 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:24:05 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
CG30259-RB 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:50:31 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
CG30259-RB 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:28:22 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
CG30259-RA 1..457 1..456 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:31:14 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
CG30259-RB 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:06:14 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
CG30259-RA 1..457 1..456 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:26:28 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22703779..22704187 191..599 100 <- Minus
2R 22704258..22704447 1..190 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:26:28 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22703779..22704187 191..599 100 <- Minus
2R 22704258..22704447 1..190 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:26:28 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22703779..22704187 191..599 100 <- Minus
2R 22704258..22704447 1..190 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:28:22 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18591284..18591692 191..599 100 <- Minus
arm_2R 18591763..18591952 1..190 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:09:42 Download gff for IP12368.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22704978..22705386 191..599 100 <- Minus
2R 22705457..22705646 1..190 100   Minus

IP12368.hyp Sequence

Translation from 49 to 480

> IP12368.hyp
MGKKGKGKGNKLANMSEEERARYLQMRADMEEETRRRKMQLISMYMKNKL
KREDAFGRLNMAKINQEWRSILRQVKIQELRREIVDVESFFQEALKRKDQ
VIHRLIAHIESTEDMYANLQQSHMENITRIVGTIGITSLKITF*

IP12368.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG30259-PA 540 CG30259-PA 1..133 1..133 661 99.2 Plus

IP12368.pep Sequence

Translation from 49 to 480

> IP12368.pep
MGKKGKGKGNKLANMSEEERARYLQMRADMEEETRRRKMQLISMYMKNKL
KREDAFGRLNMAKINQEWRSILRQVKIQELRREIVDVESFFQEALKRKDQ
VIHRLIAHIESTEDMYANLQQSHMENITRIVGTIGITSLKITF*

IP12368.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11331-PA 535 GF11331-PA 1..133 1..133 610 95.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20099-PA 543 GG20099-PA 1..133 1..133 682 97.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23667-PA 149 GH23667-PA 1..143 1..143 558 83.9 Plus
Dgri\GH22096-PA 472 GH22096-PA 1..139 1..139 554 84.2 Plus
Dgri\GH24462-PA 155 GH24462-PA 1..132 1..132 535 86.4 Plus
Dgri\GH22095-PA 232 GH22095-PA 1..47 1..47 169 89.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG30259-PA 540 CG30259-PA 1..133 1..133 661 99.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19232-PA 467 GI19232-PA 1..131 1..131 549 87.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10710-PA 629 GL10710-PA 1..140 1..143 578 86.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15731-PA 629 GA15731-PA 1..140 1..143 577 86.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15614-PA 526 GM15614-PA 1..119 15..133 612 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25108-PA 540 GD25108-PA 1..133 1..133 683 98.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20307-PA 462 GJ20307-PA 1..142 1..142 558 83.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21846-PA 448 GK21846-PA 1..132 1..132 581 90.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11840-PA 544 GE11840-PA 1..133 1..133 683 98.5 Plus