Clone IP12453 Report

Search the DGRC for IP12453

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:124
Well:53
Vector:pOT2
Associated Gene/TranscriptCG34459-RA
Protein status:IP12453.pep: gold
Preliminary Size:1392
Sequenced Size:1038

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6301 2005-01-01 Successful iPCR screen
CG34459 2008-04-29 Release 5.5 accounting
CG34459 2008-04-29 Picked prior to 5.5
CG34459 2008-08-15 Release 5.9 accounting
CG34459 2008-12-18 5.12 accounting

Clone Sequence Records

IP12453.complete Sequence

1038 bp (1038 high quality bases) assembled on 2005-03-28

GenBank Submission: BT022227

> IP12453.complete
CGAATACAATCCAACTATCTTCATGCGAATACGTGGAGTATTGGCCATGT
ATCTGATGTTCCTCCGCCTGCTACTCCACTGCACCACCGGTCACACATTG
CCTCAGCGACACAGCCCCCAGCACAAGAGAATGATCGATCCCCGTGAGCT
CTTAAACGATTTTGCTGCAATCAAGGAACCAGGAACCAGCGAAGTTGCTC
CAAAGAATTCTGCTAGATCAATTGCTTTGTACAATGCTGGTGGAGCGATG
TCAGGATCAGGAGAAGGAACCGCACCGGGACCGGGAACAGATAATTCCAA
GTCGGCCTCCAATAAGCAATGCGATCCGCAGGCAAAGTGCAATGTAAAGA
CGATCATAACCCCCGGAGATCCCAAGCAGAAATCCTCAATGATCGCAATG
AAAGCTGCACAGGATGCAAAGGCGGCCAGTGAAGCACAATCGGCCGCTGG
CCAGGCTGCTGCCCAACACATTAAGATGGAACTCGCTGAGAAGGCCTTTC
AATCGGCCAAGGCGGCCGAGGCTGCTCTGATGGGCAAACAGATGATGGTC
GATCAACTGGAGCAGGAAGTCCAGGAAGCTAGTGCCGTTGTCGAGGAGGA
GTCCAATTCGATCCACCACACGGAGGCCAATATGAATGCCGCCGTTGAAG
CTGTCAAAGTGGCCGTGCAGCAATTCGAAACCATCAATGAACTGCAGAAG
ACCGCCAGGGAGTCACTGACCAATATTCAGACGGTGGCCATGGGATCGCA
ACAGGAAATGGCCGCCAAGACACAGCTCCTGGAAGCGGCTCGCAACCGGA
TGGCCATGCTCCAAAAGCAACTGGTGAGTGCCCACGACGACTATGAGAAG
ACCAAGCAGGCCGCCTACAAGGCTGCCTGTGCCGCCGTGGAAGCCAAACA
GAGGGCTGGACCACCTGTACCACGTTACTATATTTTTTAAATAAATATAC
CTTGGTGCAGCTTTATTATGCAATTGATCCAACAAAATTATTTCCATTAA
ACTTTCATGCTAGAAACAAAAAAAAAAAAAAAAAAAAA

IP12453.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG34459-RA 1144 CG34459-RA 129..1144 1..1016 5080 100 Plus
CG14840-RA 1006 CG14840-RA 754..815 845..906 190 87 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12712918..12713835 100..1017 4560 99.8 Plus
chr2R 21145070 chr2R 12712761..12712860 1..100 485 99 Plus
chr3R 27901430 chr3R 10085220..10085281 906..845 190 87.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:15:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16825735..16826653 100..1018 4595 100 Plus
2R 25286936 2R 16825578..16825677 1..100 500 100 Plus
3R 32079331 3R 14260399..14260460 906..845 190 87.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16826934..16827852 100..1018 4595 100 Plus
2R 25260384 2R 16826777..16826876 1..100 500 100 Plus
3R 31820162 3R 14001230..14001291 906..845 190 87 Minus
Blast to na_te.dros performed on 2019-03-16 03:32:42 has no hits.

IP12453.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:33:53 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12712761..12712860 1..100 99 -> Plus
chr2R 12712919..12713835 101..1017 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:52:38 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
CG34459-RA 1..918 23..940 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:02 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
CG34459-RA 1..918 23..940 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:59:11 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
CG34459-RA 1..918 23..940 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:01 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
CG34459-RA 1..918 23..940 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:07:58 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
CG34459-RA 1..918 23..940 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:54:57 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
CG34459-RA 47..1059 1..1013 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:02 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
CG34459-RA 47..1059 1..1013 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:59:11 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
CG34459-RA 47..1059 1..1013 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:01 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
CG34459-RA 47..1059 1..1013 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:07:58 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
CG34459-RA 49..1061 1..1013 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:33:53 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16825736..16826652 101..1017 100   Plus
2R 16825578..16825677 1..100 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:33:53 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16825736..16826652 101..1017 100   Plus
2R 16825578..16825677 1..100 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:33:53 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16825736..16826652 101..1017 100   Plus
2R 16825578..16825677 1..100 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:59:11 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12713083..12713182 1..100 100 -> Plus
arm_2R 12713241..12714157 101..1017 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:00:03 Download gff for IP12453.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16826935..16827851 101..1017 100   Plus
2R 16826777..16826876 1..100 100 -> Plus

IP12453.hyp Sequence

Translation from 0 to 939

> IP12453.hyp
EYNPTIFMRIRGVLAMYLMFLRLLLHCTTGHTLPQRHSPQHKRMIDPREL
LNDFAAIKEPGTSEVAPKNSARSIALYNAGGAMSGSGEGTAPGPGTDNSK
SASNKQCDPQAKCNVKTIITPGDPKQKSSMIAMKAAQDAKAASEAQSAAG
QAAAQHIKMELAEKAFQSAKAAEAALMGKQMMVDQLEQEVQEASAVVEEE
SNSIHHTEANMNAAVEAVKVAVQQFETINELQKTARESLTNIQTVAMGSQ
QEMAAKTQLLEAARNRMAMLQKQLVSAHDDYEKTKQAAYKAACAAVEAKQ
RAGPPVPRYYIF*

IP12453.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:47:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG34459-PC 305 CG34459-PC 1..305 8..312 1525 100 Plus
CG34459-PB 305 CG34459-PB 1..305 8..312 1525 100 Plus
CG34459-PA 305 CG34459-PA 1..305 8..312 1525 100 Plus
CG14840-PA 300 CG14840-PA 28..262 66..302 521 49.2 Plus
CG14841-PA 274 CG14841-PA 49..260 94..302 473 48.6 Plus

IP12453.pep Sequence

Translation from 1 to 939

> IP12453.pep
EYNPTIFMRIRGVLAMYLMFLRLLLHCTTGHTLPQRHSPQHKRMIDPREL
LNDFAAIKEPGTSEVAPKNSARSIALYNAGGAMSGSGEGTAPGPGTDNSK
SASNKQCDPQAKCNVKTIITPGDPKQKSSMIAMKAAQDAKAASEAQSAAG
QAAAQHIKMELAEKAFQSAKAAEAALMGKQMMVDQLEQEVQEASAVVEEE
SNSIHHTEANMNAAVEAVKVAVQQFETINELQKTARESLTNIQTVAMGSQ
QEMAAKTQLLEAARNRMAMLQKQLVSAHDDYEKTKQAAYKAACAAVEAKQ
RAGPPVPRYYIF*

IP12453.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11413-PA 470 GF11413-PA 1..292 8..302 672 61.1 Plus
Dana\GF23178-PA 296 GF23178-PA 92..276 118..302 269 54.6 Plus
Dana\GF16773-PA 273 GF16773-PA 51..219 121..289 260 47.9 Plus
Dana\GF23051-PA 286 GF23051-PA 44..262 76..304 253 40.4 Plus
Dana\GF23179-PA 289 GF23179-PA 77..260 119..302 253 59.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20633-PA 462 GG20633-PA 1..292 8..308 1131 80.7 Plus
Dere\GG21383-PA 244 GG21383-PA 33..225 107..302 281 50.3 Plus
Dere\GG21391-PA 298 GG21391-PA 81..260 123..302 250 59.4 Plus
Dere\GG17458-PA 259 GG17458-PA 52..221 113..285 240 47.4 Plus
Dere\GG11426-PA 286 GG11426-PA 48..233 117..302 216 47.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20744-PA 272 GH20744-PA 1..122 181..302 371 74.6 Plus
Dgri\GH19677-PA 263 GH19677-PA 57..252 107..302 312 56.6 Plus
Dgri\GH17423-PA 238 GH17423-PA 39..218 123..302 276 51.7 Plus
Dgri\GH19676-PA 252 GH19676-PA 38..245 106..302 264 51.4 Plus
Dgri\GH19706-PA 199 GH19706-PA 9..193 121..301 259 44.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34459-PC 305 CG34459-PC 1..305 8..312 1525 100 Plus
CG34459-PB 305 CG34459-PB 1..305 8..312 1525 100 Plus
CG34459-PA 305 CG34459-PA 1..305 8..312 1525 100 Plus
CG14840-PA 300 CG14840-PA 28..262 66..302 521 49.2 Plus
CG14841-PA 274 CG14841-PA 49..260 94..302 473 48.6 Plus
CG11694-PA 261 CG11694-PA 42..240 97..302 422 47.6 Plus
CG14354-PA 298 CG14354-PA 56..239 119..302 416 47.8 Plus
CG14839-PA 282 CG14839-PA 32..256 67..301 337 40.1 Plus
CG12985-PA 370 CG12985-PA 121..297 127..303 336 42.9 Plus
CG11698-PA 262 CG11698-PA 44..224 121..301 263 37 Plus
CG33257-PA 330 CG33257-PA 97..268 131..302 202 28.5 Plus
CG11693-PA 318 CG11693-PA 112..283 131..302 200 29.7 Plus
CG11693-PB 323 CG11693-PB 117..288 131..302 200 29.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20828-PA 301 GI20828-PA 10..281 28..303 617 58.3 Plus
Dmoj\GI24533-PA 270 GI24533-PA 59..247 114..302 348 53.4 Plus
Dmoj\GI24535-PA 266 GI24535-PA 49..251 113..310 284 53.7 Plus
Dmoj\GI24534-PA 266 GI24534-PA 28..251 69..302 279 48.7 Plus
Dmoj\GI22752-PA 265 GI22752-PA 43..246 95..302 269 46.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17739-PA 409 GL17739-PA 1..296 8..302 621 53.2 Plus
Dper\GL24119-PA 264 GL24119-PA 59..239 118..298 278 48.6 Plus
Dper\GL23292-PA 280 GL23292-PA 47..258 84..308 271 52 Plus
Dper\GL24243-PA 262 GL24243-PA 36..240 77..301 252 37.6 Plus
Dper\GL21537-PA 289 GL21537-PA 50..224 112..284 239 43.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27677-PA 402 GA27677-PA 1..292 8..302 625 53.8 Plus
Dpse\GA11146-PB 267 GA11146-PB 62..255 118..311 307 47.9 Plus
Dpse\GA13287-PA 278 GA13287-PA 48..255 88..302 258 47.9 Plus
Dpse\GA27211-PA 280 GA27211-PA 72..258 122..308 257 56.7 Plus
Dpse\GA26323-PA 289 GA26323-PA 50..224 112..284 250 44.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21727-PA 455 GM21727-PA 1..284 23..310 1242 94.4 Plus
Dsec\GM25863-PA 265 GM25863-PA 18..260 19..302 308 42.4 Plus
Dsec\GM25864-PA 302 GM25864-PA 70..262 111..302 279 57 Plus
Dsec\GM10266-PA 296 GM10266-PA 59..239 122..302 234 47.5 Plus
Dsec\GM26352-PA 261 GM26352-PA 39..223 93..285 217 46.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11222-PA 470 GD11222-PA 1..299 8..307 1348 96 Plus
Dsim\GD20434-PA 264 GD20434-PA 58..259 84..302 304 47 Plus
Dsim\GD20435-PA 302 GD20435-PA 70..262 111..302 278 57 Plus
Dsim\GD21236-PA 296 GD21236-PA 59..246 122..310 238 47.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20562-PA 352 GJ20562-PA 1..248 44..302 647 64.5 Plus
Dvir\GJ22753-PA 219 GJ22753-PA 7..200 108..302 291 48.7 Plus
Dvir\GJ22600-PA 262 GJ22600-PA 70..253 119..302 285 58.7 Plus
Dvir\GJ10194-PA 307 GJ10194-PA 63..281 81..302 268 36.6 Plus
Dvir\GJ22601-PA 233 GJ22601-PA 39..218 123..302 259 56.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22021-PA 418 GK22021-PA 1..296 8..302 615 58 Plus
Dwil\GK12192-PA 270 GK12192-PA 16..253 61..301 287 41.9 Plus
Dwil\GK14387-PA 246 GK14387-PA 48..231 119..302 274 48.9 Plus
Dwil\GK11064-PA 264 GK11064-PA 30..240 79..300 240 45.5 Plus
Dwil\GK10892-PA 290 GK10892-PA 4..261 14..302 239 43.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11823-PA 449 GE11823-PA 1..288 8..308 1158 82.7 Plus
Dyak\GE10039-PA 278 GE10039-PA 64..259 107..302 295 50.5 Plus
Dyak\GE23621-PA 296 GE23621-PA 60..243 119..302 286 47.3 Plus
Dyak\GE10040-PA 301 GE10040-PA 83..263 122..302 267 59.1 Plus
Dyak\GE24857-PA 260 GE24857-PA 24..239 94..302 229 46.6 Plus