Clone IP12643 Report

Search the DGRC for IP12643

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:126
Well:43
Vector:pOT2
Associated Gene/TranscriptCG34457-RA
Protein status:IP12643.pep: gold
Preliminary Size:1305
Sequenced Size:1264

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5197 2005-01-01 Successful iPCR screen
CG34457 2008-04-29 Release 5.5 accounting
CG34457 2008-04-29 Picked prior to 5.5
CG34457 2008-08-15 Release 5.9 accounting
CG34457 2008-12-18 5.12 accounting

Clone Sequence Records

IP12643.complete Sequence

1264 bp (1264 high quality bases) assembled on 2005-04-11

GenBank Submission: BT022906

> IP12643.complete
ATTACAAACTACACAACTGCTATAGATATTAAACACCTTTATTTAGCTAC
CATCAACACATCAAAATGCCTTGCAGAGTCGGTGATATGGATTCTATTTC
CGCACGGTTTCAGCCCAGTGTAAGAATTGGCAATTGGGTCGAAGAAAATT
GCCTTGAAGAGGACAAAATAGTAAACTTTAAGAAACAACGCGATCGCGGC
GAACTTTTAGTGGAAAAGGCGCGCACTTTGTATGATAATTTCCACAAGGA
GATCGTTTTGGCTGCTCCCAAGCAAACCATTATATTCGGGGCTATTGTGC
AATTAATGCCCATCCATATAAATATCAGTGATATGGATACAACCGATTTG
AATGCCGCTTTATCGGTGGTGATCAACGAAAAGGTGGTGCGAAAAAGCCA
GTCAATCAATGAGGATTGTGAGCTATCCGTGGCGCCCTCGAAGCGGCCTT
GTGTGCGAAACTCCTTTAAAATAGTCAGTGGAGATGGTCGGGATCGCACT
GGTGAGAATATCAAATATGGACAGCGATTCCAGCTGCAGTGCATGGCCTC
GGAACACGATCCCATAGTACTGTACAGTGGGCCCAAGCGGTGCAATCTGC
AGCAGGGTGTCCATGCCACCTATTTGTCGCACAAAAACGGGGAGCTCAAT
CTCAACCTGGGACTTGTGCACCGCAGTAAATTATCATGCCCGGACAACGA
TATACCCATAGCATACACGAATTGGTTCTGCAGACATGTAAATCCAAAGC
AGCGTTTTGAAAGCGAAGGAGAAGATATACCTAGCAATTCCCCTTTGGTA
ATCGTGCATGCGACCACAAATCGAAATCTAGCTGCCGAGAATGTTCTGAT
CCAAACCCTTTTTGGTCCCGAATTTCTGGTGTCCGTGCAAAACTATCGCA
ATATCTACAGGCATGAGATTTGGAAGAACGTATGGATGATTAGCAACGGA
CACCAGACTGGATCAAAGTCTGCAAATTCTACGTCTCACTAATTTAGCTT
TTGAAGCAGCTAGGTGTTACGTGAACTTGATTTTTATGTGACGAACATTT
AAATTTCGCACATAAACTTTGTCGAGCCGAGCCCCTACTGTTTGGCCTAG
ATAGAAATTGGCACTTCACAGCTAGTTAGGGGAGAAAAAGTGGGACGGCA
CTTAAGATTATTGGTTAATGAGCATTAAGGTTCTGCAAATAACTTACTAT
GTATTCAAATCCTAGAAGTGTAATGAAATAAATGTTTAGAAATACAAAAA
AAAAAAAAAAAAAA

IP12643.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG34457-RA 1344 CG34457-RA 96..1342 1..1247 6235 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:29:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12557861..12558378 160..677 2590 100 Plus
chr2R 21145070 chr2R 12558597..12559059 783..1245 2270 99.4 Plus
chr2R 21145070 chr2R 12557643..12557804 1..162 810 100 Plus
chr2R 21145070 chr2R 12558437..12558541 678..782 480 97.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:16:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16670638..16671155 160..677 2590 100 Plus
2R 25286936 2R 16671374..16671838 783..1247 2325 100 Plus
2R 25286936 2R 16670420..16670581 1..162 810 100 Plus
2R 25286936 2R 16671214..16671318 678..782 525 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16671837..16672354 160..677 2590 100 Plus
2R 25260384 2R 16672573..16673037 783..1247 2325 100 Plus
2R 25260384 2R 16671619..16671780 1..162 810 100 Plus
2R 25260384 2R 16672413..16672517 678..782 525 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:29:11 has no hits.

IP12643.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:29:56 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12557643..12557803 1..161 100 -> Plus
chr2R 12557863..12558378 162..677 100 -> Plus
chr2R 12558437..12558541 678..782 97 -> Plus
chr2R 12558597..12559059 783..1245 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:53:10 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
CG34457-RA 1..927 66..992 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:03:06 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
CG34457-RA 1..927 66..992 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:00:57 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
CG34457-RA 1..927 66..992 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:47:36 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
CG34457-RA 1..927 66..992 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:13:54 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
CG34457-RA 1..927 66..992 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:48:30 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
CG34457-RA 95..1339 1..1245 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:03:06 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
CG34457-RA 95..1339 1..1245 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:00:57 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
CG34457-RA 95..1339 1..1245 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:47:36 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
CG34457-RA 95..1339 1..1245 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:13:54 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
CG34457-RA 95..1339 1..1245 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:56 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16670420..16670580 1..161 100 -> Plus
2R 16670640..16671155 162..677 100 -> Plus
2R 16671214..16671318 678..782 100 -> Plus
2R 16671374..16671836 783..1245 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:56 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16670420..16670580 1..161 100 -> Plus
2R 16670640..16671155 162..677 100 -> Plus
2R 16671214..16671318 678..782 100 -> Plus
2R 16671374..16671836 783..1245 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:56 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16670420..16670580 1..161 100 -> Plus
2R 16670640..16671155 162..677 100 -> Plus
2R 16671214..16671318 678..782 100 -> Plus
2R 16671374..16671836 783..1245 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:00:57 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12557925..12558085 1..161 100 -> Plus
arm_2R 12558145..12558660 162..677 100 -> Plus
arm_2R 12558719..12558823 678..782 100 -> Plus
arm_2R 12558879..12559341 783..1245 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:22:51 Download gff for IP12643.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16671839..16672354 162..677 100 -> Plus
2R 16672413..16672517 678..782 100 -> Plus
2R 16672573..16673035 783..1245 100   Plus
2R 16671619..16671779 1..161 100 -> Plus

IP12643.pep Sequence

Translation from 65 to 991

> IP12643.pep
MPCRVGDMDSISARFQPSVRIGNWVEENCLEEDKIVNFKKQRDRGELLVE
KARTLYDNFHKEIVLAAPKQTIIFGAIVQLMPIHINISDMDTTDLNAALS
VVINEKVVRKSQSINEDCELSVAPSKRPCVRNSFKIVSGDGRDRTGENIK
YGQRFQLQCMASEHDPIVLYSGPKRCNLQQGVHATYLSHKNGELNLNLGL
VHRSKLSCPDNDIPIAYTNWFCRHVNPKQRFESEGEDIPSNSPLVIVHAT
TNRNLAAENVLIQTLFGPEFLVSVQNYRNIYRHEIWKNVWMISNGHQTGS
KSANSTSH*

IP12643.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:22:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11401-PA 310 GF11401-PA 1..310 1..308 1392 81.3 Plus
Dana\GF16413-PA 282 GF16413-PA 2..281 13..293 704 46.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:22:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20621-PA 558 GG20621-PA 1..288 1..288 1543 98.6 Plus
Dere\GG14451-PA 281 GG14451-PA 2..280 15..293 712 47.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:22:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23078-PA 302 GH23078-PA 1..298 1..298 1158 69.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG34457-PB 308 CG34457-PB 1..308 1..308 1628 100 Plus
CG34457-PA 308 CG34457-PA 1..308 1..308 1628 100 Plus
CG15498-PA 281 CG15498-PA 2..277 15..290 701 47.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:22:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21147-PA 303 GI21147-PA 1..303 1..303 1173 67.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:22:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11792-PA 305 GL11792-PA 1..302 1..302 1265 76.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:22:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24075-PA 305 GA24075-PA 1..302 1..302 1257 75.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21716-PA 404 GM21716-PA 1..292 8..306 1500 94.6 Plus
Dsec\GM11003-PA 249 GM11003-PA 2..248 15..293 570 39.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11212-PA 551 GD11212-PA 1..292 8..306 1503 94.3 Plus
Dsim\GD19973-PA 281 GD19973-PA 2..280 15..293 727 48 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:22:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20995-PA 302 GJ20995-PA 1..298 1..298 1176 71.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10655-PA 303 GK10655-PA 1..301 1..302 1189 70.9 Plus
Dwil\GK14258-PA 290 GK14258-PA 5..286 14..293 708 48.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11811-PA 560 GE11811-PA 1..304 1..306 1548 94.8 Plus
Dyak\GE24971-PA 281 GE24971-PA 2..280 15..293 708 47 Plus
Dyak\GE11062-PA 262 GE11062-PA 2..261 34..293 660 47.3 Plus

IP12643.hyp Sequence

Translation from 65 to 991

> IP12643.hyp
MPCRVGDMDSISARFQPSVRIGNWVEENCLEEDKIVNFKKQRDRGELLVE
KARTLYDNFHKEIVLAAPKQTIIFGAIVQLMPIHINISDMDTTDLNAALS
VVINEKVVRKSQSINEDCELSVAPSKRPCVRNSFKIVSGDGRDRTGENIK
YGQRFQLQCMASEHDPIVLYSGPKRCNLQQGVHATYLSHKNGELNLNLGL
VHRSKLSCPDNDIPIAYTNWFCRHVNPKQRFESEGEDIPSNSPLVIVHAT
TNRNLAAENVLIQTLFGPEFLVSVQNYRNIYRHEIWKNVWMISNGHQTGS
KSANSTSH*

IP12643.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG34457-PB 308 CG34457-PB 1..308 1..308 1628 100 Plus
CG34457-PA 308 CG34457-PA 1..308 1..308 1628 100 Plus
CG15498-PA 281 CG15498-PA 2..277 15..290 701 47.3 Plus