Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
IP12925.complete Sequence
761 bp (761 high quality bases) assembled on 2005-08-26
GenBank Submission: BT023856
> IP12925.complete
ATTTGGAAACCCGTAATGAGTCATCCTTAAATTTATTGTAATGCGCTTAT
ACTTGACCTTTTTTGGAATATCAATAGTTTTTTTGGCGACCTTGCTTCAA
ATTCTTGCCATACACAGCACTGGGAATTGCACCTTCGCAAAGAATGTCAC
TCTAAAGTTCGTGTGCAAGGGAAATGTCCCCAAGGATATGTATACAATGT
TTCGGGACAACCGAGCTCCTCCCGACACTCCCTACAGTGTTTGGCAGACC
GAAGAGGACGACTCTGCTCTTCTGGTATCGTTTTACACCACGATGTTTCC
AAACTATGATACCATCAATCTGCAGGAAGGCGAGATGGATCTTGGCCAAT
TCTTTCTAGCCACCAAGGGAAGAAATACCAACGATCTTTTGTTTGTGACA
CCGTCTACCCTCCACTGCTTCCCCTTCGGTCTGCGCTATACGAATGAGCT
AAAAAGGCACTGTCTGGGCCAAGACATAAGTGAGGGAGGTGTCCTTACCA
AGAAGCCCATTATTCACTACGGCTCGCTTAGCATAAAAACCCCCGACTTG
CCGAAGAGTGATGCAACTTCGACAAGTGTGAAAAGAAACCTGCTTCTTGT
CGTGTGTGCGGTGATCACTTACTAAAATGAAAGTTTTGTACCCGAAAAAT
CTAAATTTAATGTAAAAATGATATTGTTCAAAATTGAATGAATAAATTGT
TGCGCTAGAAGAAGCGTCGCTTTCCAAATGTCAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA
IP12925.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:29:22
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG12377-RA | 1807 | CG12377-RA | 16..590 | 1..575 | 2875 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:00:13
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| chr3L | 24539361 | chr3L | 22493395..22494126 | 732..1 | 3660 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:17:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:00:11
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 22504486..22505218 | 733..1 | 3665 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:20:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28103327 | 3L | 22497586..22498318 | 733..1 | 3665 | 100 | Minus |
Blast to na_te.dros performed 2019-03-16 18:00:12
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Quasimodo | 7387 | Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. | 5184..5237 | 636..689 | 108 | 66.7 | Plus |
IP12925.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:00:54 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| chr3L | 22493395..22494126 | 1..732 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:53:50 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12377-RA | 1..541 | 41..581 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:51:55 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12377-RA | 1..541 | 41..581 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:06:33 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43329-RA | 1..585 | 41..625 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:32:36 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12377-RA | 1..541 | 41..581 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:26:11 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43329-RA | 1..585 | 41..625 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:26:11 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12377-RA | 16..596 | 1..581 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:51:55 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12377-RA | 16..596 | 1..581 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:06:33 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43329-RA | 1..732 | 1..732 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:32:37 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12377-RA | 16..596 | 1..581 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:26:11 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG43329-RA | 1..732 | 1..732 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:00:54 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 22504487..22505218 | 1..732 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:00:54 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 22504487..22505218 | 1..732 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:00:54 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 22504487..22505218 | 1..732 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:06:33 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 22497587..22498318 | 1..732 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:11:09 Download gff for
IP12925.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 22497587..22498318 | 1..732 | 100 | | Minus |
IP12925.pep Sequence
Translation from 40 to 624
> IP12925.pep
MRLYLTFFGISIVFLATLLQILAIHSTGNCTFAKNVTLKFVCKGNVPKDM
YTMFRDNRAPPDTPYSVWQTEEDDSALLVSFYTTMFPNYDTINLQEGEMD
LGQFFLATKGRNTNDLLFVTPSTLHCFPFGLRYTNELKRHCLGQDISEGG
VLTKKPIIHYGSLSIKTPDLPKSDATSTSVKRNLLLVVCAVITY*
IP12925.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:04:35
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dere\GG13180-PA | 589 | GG13180-PA | 1..180 | 1..180 | 706 | 69.4 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:04:36
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dgri\GH18135-PA | 180 | GH18135-PA | 13..173 | 26..188 | 194 | 31 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:11
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG43329-PA | 194 | CG43329-PA | 1..194 | 1..194 | 1023 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:04:37
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dper\GL23285-PA | 212 | GL23285-PA | 48..193 | 26..173 | 140 | 28.6 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:04:37
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dpse\GA28439-PA | 390 | GA28439-PA | 31..190 | 24..192 | 225 | 34.7 | Plus |
| Dpse\GA28440-PA | 209 | GA28440-PA | 45..190 | 26..173 | 142 | 28.6 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:04:38
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsec\GM22091-PA | 583 | GM22091-PA | 1..183 | 1..183 | 913 | 93.4 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:04:39
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dwil\GK17451-PA | 438 | GK17451-PA | 30..192 | 26..192 | 196 | 27.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:04:40
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dyak\GE22703-PA | 193 | GE22703-PA | 1..193 | 1..194 | 692 | 66 | Plus |
| Dyak\GE22617-PA | 582 | GE22617-PA | 1..191 | 1..192 | 648 | 63 | Plus |
IP12925.hyp Sequence
Translation from 40 to 624
> IP12925.hyp
MRLYLTFFGISIVFLATLLQILAIHSTGNCTFAKNVTLKFVCKGNVPKDM
YTMFRDNRAPPDTPYSVWQTEEDDSALLVSFYTTMFPNYDTINLQEGEMD
LGQFFLATKGRNTNDLLFVTPSTLHCFPFGLRYTNELKRHCLGQDISEGG
VLTKKPIIHYGSLSIKTPDLPKSDATSTSVKRNLLLVVCAVITY*
IP12925.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:52:17
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG43329-PA | 194 | CG43329-PA | 1..194 | 1..194 | 1023 | 100 | Plus |
