Clone IP14609 Report

Search the DGRC for IP14609

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:146
Well:9
Vector:pOT2
Associated Gene/TranscriptMes4-RA
Protein status:IP14609.pep: gold
Sequenced Size:743

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11301 2005-01-01 Successful iPCR screen
Mes4 2008-04-29 Release 5.5 accounting
Mes4 2008-08-15 Release 5.9 accounting
Mes4 2008-12-18 5.12 accounting

Clone Sequence Records

IP14609.complete Sequence

743 bp (743 high quality bases) assembled on 2005-08-25

GenBank Submission: BT022745

> IP14609.complete
ATTTGGATTGCATTCGCTTGGTTTGTTTTCAATTTTTATAGTGCGCAATG
GCCAGCGAGGAACTATTTGAGGCTGAATTCTCGGAAGAACAGGACTTGGA
GCATCAGCAGGCCATGGAGACTGAGGAGGCGGAGCTAGCGGAAACAGAAG
AGCCTTTGGAAATCACCGAGGAATCGCCGGATAATCCTGAGGCAGAATCT
ACAACAGAACAATTGACAGAAAAACCAGTGACGAATGGCAACAAGGCCCC
TGCTGATAACGAAGCCAAGATGACACAACTGCCGTTGGCCAGGATACGGA
ACATAATGAAACTAGATCCGGATCTGCATATGGCCAACAATGAGGCCGTG
TTCATAGTGGCGAAGGCAGTGGAACTATTCATAGCCTCGTTGTCACGGGA
ATCATATACCTACACGGCGCAGTCCAAAAAGAAAACCATACAAAAGAGGG
ACGTGGATATGGCCATTTCTGCTGTGGACAGTTTGCTATTCCTTGATGGA
GCCATGAACTTTTGAACACCCCCACAAATGAAACTGGATTTGTCGATTAT
ACTTTTATACTTTATTTAGGGATATTCAGCGGCAAACAAATTCAGTTCTA
AACGTCCTTATGGTTTTATGTTAAAAATAATATTTAAGTTATAAAACAAT
TGTTGATTCGCAAAGAAAAAAAAAAACAAAAAAGAAATCATAATTATAAA
CGACAACGTTTAACGTTTCACAATAAAAAAAAAAAAAAAAAAA

IP14609.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
Mes4-RB 792 Mes4-RB 34..756 1..725 3570 99.7 Plus
Mes4-RA 792 Mes4-RA 34..756 1..725 3570 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18298601..18299098 225..724 2435 99.6 Plus
chr2R 21145070 chr2R 18298323..18298550 1..228 1140 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:22:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22412085..22412583 225..725 2440 99.6 Plus
2R 25286936 2R 22411807..22412034 1..228 1140 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22413284..22413782 225..725 2450 99.6 Plus
2R 25260384 2R 22413006..22413233 1..228 1140 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:16:14 has no hits.

IP14609.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:16:50 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18298323..18298550 1..228 100 -> Plus
chr2R 18298605..18299098 229..724 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:57:16 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
Mes4-RA 1..468 48..515 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:53:39 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
Mes4-RB 1..468 48..515 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:13:28 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
Mes4-RA 1..468 48..515 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:34:22 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
Mes4-RA 1..468 48..515 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:38:55 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
Mes4-RA 1..468 48..515 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:28:46 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
Mes4-RA 1..722 1..724 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:53:39 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
Mes4-RB 1..722 1..724 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:13:28 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
Mes4-RB 19..740 1..724 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:34:22 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
Mes4-RA 1..722 1..724 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:38:55 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
Mes4-RB 19..740 1..724 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:50 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22411807..22412034 1..228 100 -> Plus
2R 22412089..22412582 229..724 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:50 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22411807..22412034 1..228 100 -> Plus
2R 22412089..22412582 229..724 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:50 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22411807..22412034 1..228 100 -> Plus
2R 22412089..22412582 229..724 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:13:28 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18299312..18299539 1..228 100 -> Plus
arm_2R 18299594..18300087 229..724 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:12:55 Download gff for IP14609.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22413006..22413233 1..228 100 -> Plus
2R 22413288..22413781 229..724 99   Plus

IP14609.pep Sequence

Translation from 47 to 514

> IP14609.pep
MASEELFEAEFSEEQDLEHQQAMETEEAELAETEEPLEITEESPDNPEAE
STTEQLTEKPVTNGNKAPADNEAKMTQLPLARIRNIMKLDPDLHMANNEA
VFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAISAVDSLLFLD
GAMNF*

IP14609.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11889-PA 158 GF11889-PA 1..158 1..155 520 72.3 Plus
Dana\GF19549-PA 616 GF19549-PA 121..233 47..149 161 34.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22188-PA 155 GG22188-PA 1..155 1..155 590 85.2 Plus
Dere\GG17653-PA 603 GG17653-PA 151..228 72..149 159 42.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21365-PA 155 GH21365-PA 1..155 1..155 400 54.9 Plus
Dgri\GH24525-PA 691 GH24525-PA 156..233 72..149 158 42.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
Mes4-PB 155 CG11301-PB 1..155 1..155 768 100 Plus
Mes4-PA 155 CG11301-PA 1..155 1..155 768 100 Plus
Nf-YC-PA 601 CG3075-PA 148..225 72..149 156 42.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20560-PA 162 GI20560-PA 1..162 1..155 422 59.3 Plus
Dmoj\GI21605-PA 585 GI21605-PA 76..153 72..149 159 42.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17544-PA 152 GL17544-PA 1..152 1..155 473 63.1 Plus
Dper\GL26874-PA 511 GL26874-PA 50..127 72..149 161 42.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10901-PA 152 GA10901-PA 1..152 1..155 470 62.6 Plus
Dpse\GA15909-PA 618 GA15909-PA 169..246 72..149 159 42.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15909-PA 155 GM15909-PA 1..155 1..155 687 94.8 Plus
Dsec\GM12548-PA 608 GM12548-PA 150..227 72..149 160 42.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11667-PA 155 GD11667-PA 1..155 1..155 666 92.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22414-PA 162 GJ22414-PA 1..162 1..155 424 57 Plus
Dvir\GJ16544-PA 633 GJ16544-PA 140..217 72..149 159 42.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20815-PA 154 GK20815-PA 1..154 1..155 447 63.2 Plus
Dwil\GK10349-PA 614 GK10349-PA 165..242 72..149 160 42.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14182-PA 155 GE14182-PA 1..155 1..155 629 84.5 Plus
Dyak\GE16442-PA 601 GE16442-PA 146..223 72..149 159 42.3 Plus

IP14609.hyp Sequence

Translation from 47 to 514

> IP14609.hyp
MASEELFEAEFSEEQDLEHQQAMETEEAELAETEEPLEITEESPDNPEAE
STTEQLTEKPVTNGNKAPADNEAKMTQLPLARIRNIMKLDPDLHMANNEA
VFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAISAVDSLLFLD
GAMNF*

IP14609.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
Mes4-PB 155 CG11301-PB 1..155 1..155 768 100 Plus
Mes4-PA 155 CG11301-PA 1..155 1..155 768 100 Plus
Nf-YC-PA 601 CG3075-PA 148..225 72..149 156 42.3 Plus