BDGP Sequence Production Resources |
Search the DGRC for IP14839
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 148 |
Well: | 39 |
Vector: | pOT2 |
Associated Gene/Transcript | CG11876-RB |
Protein status: | IP14839.pep: gold |
Sequenced Size: | 946 |
Gene | Date | Evidence |
---|---|---|
CG11876 | 2008-04-29 | Release 5.5 accounting |
CG11876 | 2008-08-15 | Release 5.9 accounting |
CG11876 | 2008-12-18 | 5.12 accounting |
946 bp (946 high quality bases) assembled on 2005-11-21
GenBank Submission: BT024274
> IP14839.complete TCGCCGGCAACGATAGCGATAGACCCATAGGAAAGCGAACCGCAAACCGA CGATGCTCCGAACCCGACTCATCCAGGCGGCCAGCTCCGCCCAGCGAGCG TTCTCCACCAGCCAGAAGGCCCTGGCGGCCAAGCAGATGACCGTGCGAGA TGCCCTCAACAGCGCATTGGACGATGAGCTGGCCCGCGACGACCGCGTCT TCATCCTGGGCGAGGAGGTGGCCCAGTACGACGGTGCTTACAAGGTTTCC CGTGGACTGTGGAAGAAGTACGGCGACAAGCGCGTCATCGACACGCCAAT CACAGAGATGGGCTTTGCCGGCATCGCTGTTGGCGCTGCCATGGCCGGTC TGCGTCCCGTGTGCGAGTTCATGACCTGGAACTTCTCCATGCAGGCCATC GATCACGCAAAGATACTCGATTGCGCCAAGCCGCCAGTCGGTGATCGCCC TCTGCCAATAAGCCTCATAATTGAAAGTCCACGCTCAACTTGGCTGAATG AGATCAACGACATCCTGCACAGAGATCGAGTCGGCGAGGTGATTGCGCCG CCGCTGGACAAGAGCAAGTCGGACAAGATGGAGGCGGCCCGCCTCATCGT CATTCGGCGGCGCAAGATGAAGAAGCACAAGCTAAAGAAGCTGCGTCGCA AGATGAAGTTCGAGTGGGCCAAGGTGCGCCAGCGCCGCGAGATGCGCAAA GAGAAGGCCTTCCAAGCAAAGCTGATATCCCAGATCAAGCAGGCGGAGGC ATTCAGTGCGGAGCAGCACGTGGCGGAGATCCTGCGGCAGGCCAACGAGA CGCCGCTGCCGCGTTTCTGGAAGGGACGCCGCCTGCCGGCATTTATCATT AAGCAGAAACTAGGCATTAAGTAAAGATCAAGACGGAACAGAAAGGAGTG CATCAAATAAAGCGTATTAACTTGAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 24937326..24937843 | 407..924 | 2590 | 100 | Plus |
chr3R | 27901430 | chr3R | 24936105..24936348 | 3..246 | 1205 | 99.6 | Plus |
chr3R | 27901430 | chr3R | 24936889..24937053 | 243..407 | 825 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 29114429..29114948 | 407..926 | 2600 | 100 | Plus |
3R | 32079331 | 3R | 29113208..29113451 | 3..246 | 1220 | 100 | Plus |
3R | 32079331 | 3R | 29113992..29114156 | 243..407 | 825 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 28855260..28855779 | 407..926 | 2600 | 100 | Plus |
3R | 31820162 | 3R | 28854039..28854282 | 3..246 | 1220 | 100 | Plus |
3R | 31820162 | 3R | 28854823..28854987 | 243..407 | 825 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 24936101..24936346 | 1..244 | 98 | -> | Plus |
chr3R | 24936891..24937052 | 245..406 | 100 | -> | Plus |
chr3R | 24937326..24937843 | 407..924 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11876-RB | 1..822 | 53..874 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11876-RB | 1..822 | 53..874 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11876-RC | 1..822 | 53..874 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11876-RB | 1..822 | 53..874 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11876-RC | 1..822 | 53..874 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11876-RC | 68..941 | 1..874 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11876-RC | 68..991 | 1..924 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11876-RC | 68..991 | 1..924 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11876-RC | 68..941 | 1..874 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11876-RC | 68..991 | 1..924 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29113204..29113449 | 1..244 | 99 | -> | Plus |
3R | 29113994..29114155 | 245..406 | 100 | -> | Plus |
3R | 29114429..29114946 | 407..924 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29113204..29113449 | 1..244 | 99 | -> | Plus |
3R | 29113994..29114155 | 245..406 | 100 | -> | Plus |
3R | 29114429..29114946 | 407..924 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29113204..29113449 | 1..244 | 99 | -> | Plus |
3R | 29113994..29114155 | 245..406 | 100 | -> | Plus |
3R | 29114429..29114946 | 407..924 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 24938926..24939171 | 1..244 | 99 | -> | Plus |
arm_3R | 24939716..24939877 | 245..406 | 100 | -> | Plus |
arm_3R | 24940151..24940668 | 407..924 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 28854035..28854280 | 1..244 | 99 | -> | Plus |
3R | 28854825..28854986 | 245..406 | 100 | -> | Plus |
3R | 28855260..28855777 | 407..924 | 100 | Plus |
Translation from 52 to 873
> IP14839.pep MLRTRLIQAASSAQRAFSTSQKALAAKQMTVRDALNSALDDELARDDRVF ILGEEVAQYDGAYKVSRGLWKKYGDKRVIDTPITEMGFAGIAVGAAMAGL RPVCEFMTWNFSMQAIDHAKILDCAKPPVGDRPLPISLIIESPRSTWLNE INDILHRDRVGEVIAPPLDKSKSDKMEAARLIVIRRRKMKKHKLKKLRRK MKFEWAKVRQRREMRKEKAFQAKLISQIKQAEAFSAEQHVAEILRQANET PLPRFWKGRRLPAFIIKQKLGIK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23287-PA | 509 | GF23287-PA | 1..262 | 1..262 | 1100 | 88.9 | Plus |
Dana\GF15686-PA | 505 | GF15686-PA | 181..271 | 26..117 | 154 | 32.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11642-PA | 365 | GG11642-PA | 1..118 | 1..118 | 624 | 99.2 | Plus |
Dere\GG23089-PA | 361 | GG23089-PA | 36..127 | 25..117 | 157 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19645-PA | 360 | GH19645-PA | 1..118 | 1..118 | 560 | 86.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Pdhb-PB | 273 | CG11876-PB | 1..273 | 1..273 | 1384 | 100 | Plus |
Pdhb-PC | 273 | CG11876-PC | 1..273 | 1..273 | 1384 | 100 | Plus |
Pdhb-PD | 365 | CG11876-PD | 1..118 | 1..118 | 596 | 100 | Plus |
Pdhb-PA | 365 | CG11876-PA | 1..118 | 1..118 | 596 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22271-PA | 356 | GI22271-PA | 1..118 | 1..118 | 574 | 89.8 | Plus |
Dmoj\GI18255-PA | 364 | GI18255-PA | 16..130 | 7..117 | 154 | 30.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23909-PA | 365 | GL23909-PA | 1..118 | 1..118 | 571 | 89 | Plus |
Dper\GL21161-PA | 347 | GL21161-PA | 14..113 | 17..117 | 160 | 32.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11252-PB | 275 | GA11252-PB | 1..275 | 1..273 | 1145 | 86.2 | Plus |
Dpse\GA11252-PA | 365 | GA11252-PA | 1..118 | 1..118 | 571 | 89 | Plus |
Dpse\GA29202-PA | 347 | GA29202-PA | 14..113 | 17..117 | 160 | 32.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12765-PA | 365 | GM12765-PA | 1..118 | 1..118 | 626 | 100 | Plus |
Dsec\GM10081-PA | 364 | GM10081-PA | 40..130 | 26..117 | 155 | 33.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21413-PA | 448 | GD21413-PA | 1..202 | 1..240 | 842 | 73.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24064-PA | 360 | GJ24064-PA | 1..118 | 1..118 | 580 | 90.7 | Plus |
Dvir\GJ17514-PA | 364 | GJ17514-PA | 17..130 | 8..117 | 157 | 30.4 | Plus |
Translation from 52 to 873
> IP14839.hyp MLRTRLIQAASSAQRAFSTSQKALAAKQMTVRDALNSALDDELARDDRVF ILGEEVAQYDGAYKVSRGLWKKYGDKRVIDTPITEMGFAGIAVGAAMAGL RPVCEFMTWNFSMQAIDHAKILDCAKPPVGDRPLPISLIIESPRSTWLNE INDILHRDRVGEVIAPPLDKSKSDKMEAARLIVIRRRKMKKHKLKKLRRK MKFEWAKVRQRREMRKEKAFQAKLISQIKQAEAFSAEQHVAEILRQANET PLPRFWKGRRLPAFIIKQKLGIK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11876-PB | 273 | CG11876-PB | 1..273 | 1..273 | 1384 | 100 | Plus |
CG11876-PC | 273 | CG11876-PC | 1..273 | 1..273 | 1384 | 100 | Plus |
CG11876-PD | 365 | CG11876-PD | 1..118 | 1..118 | 596 | 100 | Plus |
CG11876-PA | 365 | CG11876-PA | 1..118 | 1..118 | 596 | 100 | Plus |