Clone IP14839 Report

Search the DGRC for IP14839

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:148
Well:39
Vector:pOT2
Associated Gene/TranscriptCG11876-RB
Protein status:IP14839.pep: gold
Sequenced Size:946

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11876 2008-04-29 Release 5.5 accounting
CG11876 2008-08-15 Release 5.9 accounting
CG11876 2008-12-18 5.12 accounting

Clone Sequence Records

IP14839.complete Sequence

946 bp (946 high quality bases) assembled on 2005-11-21

GenBank Submission: BT024274

> IP14839.complete
TCGCCGGCAACGATAGCGATAGACCCATAGGAAAGCGAACCGCAAACCGA
CGATGCTCCGAACCCGACTCATCCAGGCGGCCAGCTCCGCCCAGCGAGCG
TTCTCCACCAGCCAGAAGGCCCTGGCGGCCAAGCAGATGACCGTGCGAGA
TGCCCTCAACAGCGCATTGGACGATGAGCTGGCCCGCGACGACCGCGTCT
TCATCCTGGGCGAGGAGGTGGCCCAGTACGACGGTGCTTACAAGGTTTCC
CGTGGACTGTGGAAGAAGTACGGCGACAAGCGCGTCATCGACACGCCAAT
CACAGAGATGGGCTTTGCCGGCATCGCTGTTGGCGCTGCCATGGCCGGTC
TGCGTCCCGTGTGCGAGTTCATGACCTGGAACTTCTCCATGCAGGCCATC
GATCACGCAAAGATACTCGATTGCGCCAAGCCGCCAGTCGGTGATCGCCC
TCTGCCAATAAGCCTCATAATTGAAAGTCCACGCTCAACTTGGCTGAATG
AGATCAACGACATCCTGCACAGAGATCGAGTCGGCGAGGTGATTGCGCCG
CCGCTGGACAAGAGCAAGTCGGACAAGATGGAGGCGGCCCGCCTCATCGT
CATTCGGCGGCGCAAGATGAAGAAGCACAAGCTAAAGAAGCTGCGTCGCA
AGATGAAGTTCGAGTGGGCCAAGGTGCGCCAGCGCCGCGAGATGCGCAAA
GAGAAGGCCTTCCAAGCAAAGCTGATATCCCAGATCAAGCAGGCGGAGGC
ATTCAGTGCGGAGCAGCACGTGGCGGAGATCCTGCGGCAGGCCAACGAGA
CGCCGCTGCCGCGTTTCTGGAAGGGACGCCGCCTGCCGGCATTTATCATT
AAGCAGAAACTAGGCATTAAGTAAAGATCAAGACGGAACAGAAAGGAGTG
CATCAAATAAAGCGTATTAACTTGAAAAAAAAAAAAAAAAAAAAAA

IP14839.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG11876-RC 1098 CG11876-RC 114..1039 1..926 4630 100 Plus
CG11876-RB 1124 CG11876-RB 142..1065 3..926 4620 100 Plus
CG11876-RA 1514 CG11876-RA 114..519 1..406 2030 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24937326..24937843 407..924 2590 100 Plus
chr3R 27901430 chr3R 24936105..24936348 3..246 1205 99.6 Plus
chr3R 27901430 chr3R 24936889..24937053 243..407 825 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:23:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29114429..29114948 407..926 2600 100 Plus
3R 32079331 3R 29113208..29113451 3..246 1220 100 Plus
3R 32079331 3R 29113992..29114156 243..407 825 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28855260..28855779 407..926 2600 100 Plus
3R 31820162 3R 28854039..28854282 3..246 1220 100 Plus
3R 31820162 3R 28854823..28854987 243..407 825 100 Plus
Blast to na_te.dros performed on 2019-03-16 09:32:03 has no hits.

IP14839.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:32:48 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24936101..24936346 1..244 98 -> Plus
chr3R 24936891..24937052 245..406 100 -> Plus
chr3R 24937326..24937843 407..924 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:57:47 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RB 1..822 53..874 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:46:04 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RB 1..822 53..874 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:41:41 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RC 1..822 53..874 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:27:37 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RB 1..822 53..874 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:13:07 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RC 1..822 53..874 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:19:22 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RC 68..941 1..874 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:46:04 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RC 68..991 1..924 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:41:41 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RC 68..991 1..924 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:27:37 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RC 68..941 1..874 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:13:07 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
CG11876-RC 68..991 1..924 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:32:48 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29113204..29113449 1..244 99 -> Plus
3R 29113994..29114155 245..406 100 -> Plus
3R 29114429..29114946 407..924 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:32:48 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29113204..29113449 1..244 99 -> Plus
3R 29113994..29114155 245..406 100 -> Plus
3R 29114429..29114946 407..924 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:32:48 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29113204..29113449 1..244 99 -> Plus
3R 29113994..29114155 245..406 100 -> Plus
3R 29114429..29114946 407..924 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:41:41 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24938926..24939171 1..244 99 -> Plus
arm_3R 24939716..24939877 245..406 100 -> Plus
arm_3R 24940151..24940668 407..924 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:06:35 Download gff for IP14839.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28854035..28854280 1..244 99 -> Plus
3R 28854825..28854986 245..406 100 -> Plus
3R 28855260..28855777 407..924 100   Plus

IP14839.pep Sequence

Translation from 52 to 873

> IP14839.pep
MLRTRLIQAASSAQRAFSTSQKALAAKQMTVRDALNSALDDELARDDRVF
ILGEEVAQYDGAYKVSRGLWKKYGDKRVIDTPITEMGFAGIAVGAAMAGL
RPVCEFMTWNFSMQAIDHAKILDCAKPPVGDRPLPISLIIESPRSTWLNE
INDILHRDRVGEVIAPPLDKSKSDKMEAARLIVIRRRKMKKHKLKKLRRK
MKFEWAKVRQRREMRKEKAFQAKLISQIKQAEAFSAEQHVAEILRQANET
PLPRFWKGRRLPAFIIKQKLGIK*

IP14839.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23287-PA 509 GF23287-PA 1..262 1..262 1100 88.9 Plus
Dana\GF15686-PA 505 GF15686-PA 181..271 26..117 154 32.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11642-PA 365 GG11642-PA 1..118 1..118 624 99.2 Plus
Dere\GG23089-PA 361 GG23089-PA 36..127 25..117 157 33.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19645-PA 360 GH19645-PA 1..118 1..118 560 86.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
Pdhb-PB 273 CG11876-PB 1..273 1..273 1384 100 Plus
Pdhb-PC 273 CG11876-PC 1..273 1..273 1384 100 Plus
Pdhb-PD 365 CG11876-PD 1..118 1..118 596 100 Plus
Pdhb-PA 365 CG11876-PA 1..118 1..118 596 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22271-PA 356 GI22271-PA 1..118 1..118 574 89.8 Plus
Dmoj\GI18255-PA 364 GI18255-PA 16..130 7..117 154 30.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23909-PA 365 GL23909-PA 1..118 1..118 571 89 Plus
Dper\GL21161-PA 347 GL21161-PA 14..113 17..117 160 32.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11252-PB 275 GA11252-PB 1..275 1..273 1145 86.2 Plus
Dpse\GA11252-PA 365 GA11252-PA 1..118 1..118 571 89 Plus
Dpse\GA29202-PA 347 GA29202-PA 14..113 17..117 160 32.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12765-PA 365 GM12765-PA 1..118 1..118 626 100 Plus
Dsec\GM10081-PA 364 GM10081-PA 40..130 26..117 155 33.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21413-PA 448 GD21413-PA 1..202 1..240 842 73.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24064-PA 360 GJ24064-PA 1..118 1..118 580 90.7 Plus
Dvir\GJ17514-PA 364 GJ17514-PA 17..130 8..117 157 30.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11887-PA 512 GK11887-PA 1..269 1..268 1068 82.5 Plus
Dwil\GK23412-PA 361 GK23412-PA 38..127 27..117 156 34.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23833-PA 365 GE23833-PA 1..118 1..118 625 100 Plus
Dyak\GE15211-PA 363 GE15211-PA 22..129 10..117 152 30.3 Plus

IP14839.hyp Sequence

Translation from 52 to 873

> IP14839.hyp
MLRTRLIQAASSAQRAFSTSQKALAAKQMTVRDALNSALDDELARDDRVF
ILGEEVAQYDGAYKVSRGLWKKYGDKRVIDTPITEMGFAGIAVGAAMAGL
RPVCEFMTWNFSMQAIDHAKILDCAKPPVGDRPLPISLIIESPRSTWLNE
INDILHRDRVGEVIAPPLDKSKSDKMEAARLIVIRRRKMKKHKLKKLRRK
MKFEWAKVRQRREMRKEKAFQAKLISQIKQAEAFSAEQHVAEILRQANET
PLPRFWKGRRLPAFIIKQKLGIK*

IP14839.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:10:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG11876-PB 273 CG11876-PB 1..273 1..273 1384 100 Plus
CG11876-PC 273 CG11876-PC 1..273 1..273 1384 100 Plus
CG11876-PD 365 CG11876-PD 1..118 1..118 596 100 Plus
CG11876-PA 365 CG11876-PA 1..118 1..118 596 100 Plus