Clone IP14867 Report

Search the DGRC for IP14867

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:148
Well:67
Vector:pOT2
Associated Gene/TranscriptNot11-RB
Protein status:IP14867.pep: gold
Sequenced Size:924

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13567 2008-04-29 Release 5.5 accounting
CG13567 2008-08-15 Release 5.9 accounting
CG13567 2008-12-18 5.12 accounting

Clone Sequence Records

IP14867.complete Sequence

924 bp (924 high quality bases) assembled on 2005-11-21

GenBank Submission: BT024271

> IP14867.complete
CTAACACCCTTAGGCGCACATTTGCATACATCATTTTTCAGATGGCCCAC
TCTCATGTGCAGATTGTTCTTAAGAACCCCTCAACGCGGTCACACTAAAA
TTGTTTACAAAATTGCAAGGAAAATAATAATAATTGTAAATTAAAATCAG
CGCACCAGCATGTTTCTGTCCATCGCCCCGCCCCTAATGGACTTCGAGGA
CGAGCTGCTCTGGATAAACCAGTCGAACAGCGACAAGGTGGAGATCATCT
ACGACAAGTCCAACTACATTACCCCCAACATAAAGCACCTCATCGAGCAG
GCTTTTCTCCAGCCACTCAGCCTCCAGAACCAGCACATCCTCTTCGACGA
CCTGCTGAAGCAGAACACGGACATTGCGCGCCAATATGGACTGACCCCGG
ACAAGCTACCTCTGCTCGTGGAAAGCAATCCTCTCATCTCCATTGAGATC
TTGCTAAGACTGATGACGACCTCCGACATAACTGAATACTTCAACGTGTT
GGTCAACATGGACATAACACTTCACTCCATGGAGGTGGTCAACCGACTAA
CCACCTCCGGACCTTTGCCCACTGAGTTTATTCACCTATACATCAGCAAT
TGCATCTCGACTTGCGAAACAGTCAAGGACAAGTACATGCAGTCTCGCCT
GGTGCGACTCGTTTGCGTATTTCTGCAGTCCTTGATTAGGAACAAGATTG
TGAACGTTAGGGAACTATTCATTGAAATCGAAGCCTTCTGCGTGGGTTTC
AGCAAAATCAAGGAGGCTGCTACCCTGTACCGGCTTATCAAACACTTGGA
AACTGGGGAAAGCGCTCTGTCGTCCAACTCCCTAGCTAAGTAGTGGTAGT
GTTTAGCAGATTTTAAGTTTTAAAGTCTAGTTCATAATAAATCGATTAAA
TACGACAAAAAAAAAAAAAAAAAA

IP14867.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13567-RB 1061 CG13567-RB 119..1026 1..908 4540 100 Plus
CG13567-RA 1025 CG13567-RA 23..734 1..712 3560 100 Plus
CG13567-RA 1025 CG13567-RA 793..990 711..908 990 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:26:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19923430..19923832 405..3 1970 99.3 Minus
chr2R 21145070 chr2R 19922755..19922950 906..711 950 99 Minus
chr2R 21145070 chr2R 19923009..19923176 712..545 840 100 Minus
chr2R 21145070 chr2R 19923236..19923377 545..404 710 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:23:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:26:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24037395..24037799 405..1 2025 100 Minus
2R 25286936 2R 24036718..24036915 908..711 990 100 Minus
2R 25286936 2R 24036974..24037141 712..545 840 100 Minus
2R 25286936 2R 24037201..24037342 545..404 710 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24038594..24038998 405..1 2025 100 Minus
2R 25260384 2R 24037917..24038114 908..711 990 100 Minus
2R 25260384 2R 24038173..24038340 712..545 840 100 Minus
2R 25260384 2R 24038400..24038541 545..404 710 100 Minus
Blast to na_te.dros performed on 2019-03-16 00:26:55 has no hits.

IP14867.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:27:50 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19922755..19922949 712..906 98 <- Minus
chr2R 19923010..19923175 546..711 100 <- Minus
chr2R 19923236..19923375 406..545 100 <- Minus
chr2R 19923430..19923833 1..405 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:57:55 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
CG13567-RB 1..684 160..843 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:46:06 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
CG13567-RB 1..684 160..843 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:12 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
CG13567-RB 1..684 160..843 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:27:39 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
CG13567-RB 1..684 160..843 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:01:17 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
Not11-RB 1..684 160..843 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:19:24 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
CG13567-RB 1..906 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:46:06 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
CG13567-RB 1..906 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:12 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
CG13567-RC 117..1022 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:27:39 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
CG13567-RB 1..906 1..906 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:01:17 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
Not11-RC 117..1022 1..906 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:27:50 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24036720..24036914 712..906 100 <- Minus
2R 24036975..24037140 546..711 100 <- Minus
2R 24037201..24037340 406..545 100 <- Minus
2R 24037395..24037799 1..405 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:27:50 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24036720..24036914 712..906 100 <- Minus
2R 24036975..24037140 546..711 100 <- Minus
2R 24037201..24037340 406..545 100 <- Minus
2R 24037395..24037799 1..405 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:27:50 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24036720..24036914 712..906 100 <- Minus
2R 24036975..24037140 546..711 100 <- Minus
2R 24037201..24037340 406..545 100 <- Minus
2R 24037395..24037799 1..405 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:12 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19924918..19925322 1..405 100   Minus
arm_2R 19924243..19924437 712..906 100 <- Minus
arm_2R 19924498..19924663 546..711 100 <- Minus
arm_2R 19924724..19924863 406..545 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:06:36 Download gff for IP14867.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24038612..24039016 1..405 100   Minus
2R 24037937..24038131 712..906 100 <- Minus
2R 24038192..24038357 546..711 100 <- Minus
2R 24038418..24038557 406..545 100 <- Minus

IP14867.pep Sequence

Translation from 159 to 842

> IP14867.pep
MFLSIAPPLMDFEDELLWINQSNSDKVEIIYDKSNYITPNIKHLIEQAFL
QPLSLQNQHILFDDLLKQNTDIARQYGLTPDKLPLLVESNPLISIEILLR
LMTTSDITEYFNVLVNMDITLHSMEVVNRLTTSGPLPTEFIHLYISNCIS
TCETVKDKYMQSRLVRLVCVFLQSLIRNKIVNVRELFIEIEAFCVGFSKI
KEAATLYRLIKHLETGESALSSNSLAK*

IP14867.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12036-PA 227 GF12036-PA 1..227 1..227 1127 93.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19961-PA 227 GG19961-PA 1..227 1..227 1161 96.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21707-PA 228 GH21707-PA 1..227 1..227 1014 84.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
Not11-PC 227 CG13567-PC 1..227 1..227 1146 100 Plus
Not11-PB 227 CG13567-PB 1..227 1..227 1146 100 Plus
Not11-PA 247 CG13567-PA 1..247 1..227 1115 91.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20696-PA 228 GI20696-PA 1..227 1..227 1002 82.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10429-PA 228 GL10429-PA 1..227 1..227 1097 91.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12367-PA 228 GA12367-PA 1..227 1..227 1097 91.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18281-PA 227 GM18281-PA 1..227 1..227 1174 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24978-PA 227 GD24978-PA 1..227 1..227 1174 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20443-PA 229 GJ20443-PA 1..226 1..226 986 81.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21382-PA 227 GK21382-PA 1..227 1..227 998 84.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11493-PA 227 GE11493-PA 1..227 1..227 1172 97.8 Plus

IP14867.hyp Sequence

Translation from 159 to 842

> IP14867.hyp
MFLSIAPPLMDFEDELLWINQSNSDKVEIIYDKSNYITPNIKHLIEQAFL
QPLSLQNQHILFDDLLKQNTDIARQYGLTPDKLPLLVESNPLISIEILLR
LMTTSDITEYFNVLVNMDITLHSMEVVNRLTTSGPLPTEFIHLYISNCIS
TCETVKDKYMQSRLVRLVCVFLQSLIRNKIVNVRELFIEIEAFCVGFSKI
KEAATLYRLIKHLETGESALSSNSLAK*

IP14867.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Not11-PC 227 CG13567-PC 1..227 1..227 1146 100 Plus
Not11-PB 227 CG13567-PB 1..227 1..227 1146 100 Plus
Not11-PA 247 CG13567-PA 1..247 1..227 1115 91.9 Plus