IP15629.complete Sequence
1007 bp (1007 high quality bases) assembled on 2005-11-21
GenBank Submission: BT024268
> IP15629.complete
AACAAATCGGTCGTTCAAAATTCGTGTTCACAAAAACATAAATTTTCAGT
TTTTTTTTCTTCCCTCAAAAAATTTTAAGAAATATTTAAACCAGCTTCAC
GATGTGTTGTAAGTCGTGCGAAGAACAACCAGCATCATGCTGCTCGACTT
TCTATGCATTTTTCTGCATGGGAGCAGGATTCTTTATGTTTAGCTTCTCG
CTGCACAATGTAATTATATCAGAAGAGTCTATTACCATTATGGATTGGTT
TCTGCACATACATGGCACTGATTTGACGGAAAAACAGCTTTTGATATTGT
ACGCTTCGGATTTAATTTTTGCCTTTACGTATGTCCTCGCAGGAGTTTTG
CTAGCTTGGGGAATCAAAAGCAAAACAAAGGGATTTATTAAAGCTGGAAA
GATCTTAAGCTATTTCTTTCCCATATATAATATTGTTTATGTATTTCCAT
TAGTTATACATATTGGCTGTGTGATAAAATTATGCAGATATCTAAAGGAA
AACTTTGATTAGAGCAGAGTTGGATATTCTCAAACCTAATAAATTCGACG
ATAACAAAATTGACTGTCACAAGGATGCAACAAAGGATACATTTGTATAT
ATATATACATAATTGTGGACTCATTTCAGCTTTTACAATAGTTAACATAA
TTTATACGTGGAAAAAATGCACAGCAAGAAAATTATTCGGTAATTCGCAG
TGCCGACCGATGATCAAAATTGACTTTGCTTTTGAGTGTTGTAATAGATA
CATATATCCTATTACCATCTAATACTGTAATCATTTGTCTACGGCATTTT
TACTTTGTAAAAATATTCAGCAGTATAAGGAAATCGTGAAAATTCAAAGT
GGCTACGAATCGGATAGACTGAAATTTGCAATGCAATTCAAAATTTGTAT
TATAGCAGCAAACCAATTTCATTCCGAGGAAAATTTTTTGTGAAACTATA
TACCAAAATAAGTGAAAACTGTATTAAAATAAATATTTTCAAAAAAAAAA
AAAAAAA
IP15629.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:25:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32192-RB | 1083 | CG32192-RB | 69..1061 | 1..993 | 4965 | 100 | Plus |
CG32192-RC | 987 | CG32192-RC | 374..986 | 381..993 | 3065 | 100 | Plus |
CG32192-RC | 987 | CG32192-RC | 3..373 | 1..371 | 1855 | 100 | Plus |
CG42393-RA | 1236 | CG42393-RA | 1030..1132 | 795..896 | 280 | 86.4 | Plus |
CG42393-RA | 1236 | CG42393-RA | 487..559 | 393..465 | 200 | 84.9 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:10:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 18030012..18030382 | 1..371 | 1855 | 100 | Plus |
chr3L | 24539361 | chr3L | 18030618..18030818 | 451..651 | 990 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 18031239..18031431 | 798..990 | 950 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 18030877..18031022 | 652..797 | 730 | 100 | Plus |
chr3L | 24539361 | chr3L | 18030456..18030537 | 372..453 | 410 | 100 | Plus |
chr3L | 24539361 | chr3L | 18033715..18033811 | 801..896 | 255 | 86.6 | Plus |
chr3L | 24539361 | chr3L | 18032901..18032960 | 393..452 | 195 | 88.3 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:25:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:10:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 18040319..18040689 | 1..371 | 1855 | 100 | Plus |
3L | 28110227 | 3L | 18040925..18041125 | 451..651 | 1005 | 100 | Plus |
3L | 28110227 | 3L | 18041546..18041741 | 798..993 | 980 | 100 | Plus |
3L | 28110227 | 3L | 18041184..18041329 | 652..797 | 730 | 100 | Plus |
3L | 28110227 | 3L | 18040763..18040844 | 372..453 | 410 | 100 | Plus |
3L | 28110227 | 3L | 18044021..18044117 | 801..896 | 255 | 86.6 | Plus |
3L | 28110227 | 3L | 18043207..18043266 | 393..452 | 195 | 88.3 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:17:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 18033419..18033789 | 1..371 | 1855 | 100 | Plus |
3L | 28103327 | 3L | 18034025..18034225 | 451..651 | 1005 | 100 | Plus |
3L | 28103327 | 3L | 18034646..18034841 | 798..993 | 980 | 100 | Plus |
3L | 28103327 | 3L | 18034284..18034429 | 652..797 | 730 | 100 | Plus |
3L | 28103327 | 3L | 18033863..18033944 | 372..453 | 410 | 100 | Plus |
3L | 28103327 | 3L | 18037121..18037217 | 801..896 | 265 | 86.5 | Plus |
3L | 28103327 | 3L | 18036307..18036366 | 393..452 | 195 | 88.3 | Plus |
Blast to na_te.dros performed 2019-03-16 02:10:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
transib1 | 2167 | transib1 TRANSIB1 2167bp | 1870..1960 | 372..462 | 120 | 64.5 | Plus |
mdg1 | 7480 | mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). | 6905..7001 | 510..413 | 118 | 62 | Minus |
Dyak\HeT-A | 5691 | Dyak\HeT-A YAKHETA 5691bp | 91..283 | 798..989 | 117 | 54.3 | Plus |
Tc3 | 1743 | Tc3 TC3 1743bp | 259..328 | 423..493 | 109 | 63.4 | Plus |
IP15629.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:11:14 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 18030012..18030382 | 1..371 | 100 | -> | Plus |
chr3L | 18030456..18030537 | 372..453 | 100 | -> | Plus |
chr3L | 18030621..18030818 | 454..651 | 99 | -> | Plus |
chr3L | 18030877..18031022 | 652..797 | 100 | -> | Plus |
chr3L | 18031239..18031431 | 798..990 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:59:46 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32192-RB | 1..411 | 102..512 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:45:47 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32192-RB | 1..411 | 102..512 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:58:43 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32192-RB | 1..411 | 102..512 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:27:15 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32192-RB | 1..411 | 102..512 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:59:59 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32192-RB | 1..411 | 102..512 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:19:02 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32192-RB | 3..992 | 1..990 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:45:47 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32192-RB | 3..992 | 1..990 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:58:43 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32192-RB | 3..992 | 1..990 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:27:15 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32192-RB | 3..580 | 1..578 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:59:59 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32192-RB | 3..992 | 1..990 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:11:14 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 18040319..18040689 | 1..371 | 100 | -> | Plus |
3L | 18040763..18040844 | 372..453 | 100 | -> | Plus |
3L | 18040928..18041125 | 454..651 | 100 | -> | Plus |
3L | 18041184..18041329 | 652..797 | 100 | -> | Plus |
3L | 18041546..18041738 | 798..990 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:11:14 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 18040319..18040689 | 1..371 | 100 | -> | Plus |
3L | 18040763..18040844 | 372..453 | 100 | -> | Plus |
3L | 18040928..18041125 | 454..651 | 100 | -> | Plus |
3L | 18041184..18041329 | 652..797 | 100 | -> | Plus |
3L | 18041546..18041738 | 798..990 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:11:14 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 18040319..18040689 | 1..371 | 100 | -> | Plus |
3L | 18040763..18040844 | 372..453 | 100 | -> | Plus |
3L | 18040928..18041125 | 454..651 | 100 | -> | Plus |
3L | 18041184..18041329 | 652..797 | 100 | -> | Plus |
3L | 18041546..18041738 | 798..990 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:58:43 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 18034646..18034838 | 798..990 | 100 | | Plus |
arm_3L | 18033419..18033789 | 1..371 | 100 | -> | Plus |
arm_3L | 18033863..18033944 | 372..453 | 100 | -> | Plus |
arm_3L | 18034028..18034225 | 454..651 | 100 | -> | Plus |
arm_3L | 18034284..18034429 | 652..797 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:06:24 Download gff for
IP15629.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 18033419..18033789 | 1..371 | 100 | -> | Plus |
3L | 18033863..18033944 | 372..453 | 100 | -> | Plus |
3L | 18034028..18034225 | 454..651 | 100 | -> | Plus |
3L | 18034284..18034429 | 652..797 | 100 | -> | Plus |
3L | 18034646..18034838 | 798..990 | 100 | | Plus |
IP15629.hyp Sequence
Translation from 101 to 511
> IP15629.hyp
MCCKSCEEQPASCCSTFYAFFCMGAGFFMFSFSLHNVIISEESITIMDWF
LHIHGTDLTEKQLLILYASDLIFAFTYVLAGVLLAWGIKSKTKGFIKAGK
ILSYFFPIYNIVYVFPLVIHIGCVIKLCRYLKENFD*
IP15629.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:19:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32192-PB | 136 | CG32192-PB | 1..136 | 1..136 | 732 | 100 | Plus |
CG32192-PC | 133 | CG32192-PC | 1..133 | 1..136 | 703 | 97.8 | Plus |
CG42393-PA | 135 | CG42393-PA | 2..135 | 3..136 | 472 | 61.2 | Plus |
IP15629.pep Sequence
Translation from 101 to 511
> IP15629.pep
MCCKSCEEQPASCCSTFYAFFCMGAGFFMFSFSLHNVIISEESITIMDWF
LHIHGTDLTEKQLLILYASDLIFAFTYVLAGVLLAWGIKSKTKGFIKAGK
ILSYFFPIYNIVYVFPLVIHIGCVIKLCRYLKENFD*
IP15629.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:40:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13645-PA | 136 | GG13645-PA | 1..136 | 1..136 | 599 | 78.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32192-PB | 136 | CG32192-PB | 1..136 | 1..136 | 732 | 100 | Plus |
CG32192-PC | 133 | CG32192-PC | 1..133 | 1..136 | 703 | 97.8 | Plus |
CG42393-PA | 135 | CG42393-PA | 2..135 | 3..136 | 472 | 61.2 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:41:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14959-PA | 136 | GM14959-PA | 1..136 | 1..136 | 643 | 90.4 | Plus |
Dsec\GM14960-PA | 135 | GM14960-PA | 2..135 | 3..136 | 454 | 59 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:41:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14739-PA | 135 | GD14739-PA | 2..135 | 3..136 | 460 | 61.2 | Plus |
Dsim\GD14738-PA | 141 | GD14738-PA | 1..141 | 1..136 | 272 | 43.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:41:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE19938-PA | 136 | GE19938-PA | 1..136 | 1..136 | 570 | 74.3 | Plus |