Clone IP15694 Report

Search the DGRC for IP15694

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:156
Well:94
Vector:pOT2
Associated Gene/TranscriptCG34456-RA
Protein status:IP15694.pep: gold
Sequenced Size:646

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34456 2008-04-29 Release 5.5 accounting
CG34456 2008-08-15 Release 5.9 accounting
CG34456 2008-12-18 5.12 accounting

Clone Sequence Records

IP15694.complete Sequence

646 bp (646 high quality bases) assembled on 2006-03-22

GenBank Submission: BT024953

> IP15694.complete
CAACAAGTGGCTATATAAGATTGCAGCCGGCCAGTCGGGAAAAAACAAAC
CCGTAGATATGTGGCTGTCGCTTATCTTTATTGCCTGTCTAGCCGGCGCA
AGCAGTGGCGACGAGAAGATCCCGGTGGAGCAGGGATTTGTGCCCCGCTA
CACTCCGGTGGCCGAGAGCAAGCGACAGGATCTGGATTTACCCGCTGACG
TAGGCATCGAGCAGCAAAAGAGACCTGCTGCAGGCGATAAGAAACCCTGG
CGACGAGTGCAGTACGGATACGATGGAGTGCCGACTGCTGCCTGGGCTGC
TCCATCTCCACCAGCTGCCATACTGTCCATCCTGAATCCTCTGCTTGCAC
CGGGATTGCTTCTTTTGGGTGTGAATTTGGGAGCCCTGCTGTACATGCTG
CTGGGACTCCTGGGCTTGGCTCCTTATCGCAGTGGCAGCGCCAGTCGGTT
AGCCTCGCATCCGGAAACCAACTCCCAATTCTGGCCGTGCGATCAAAGCT
TCTACCACCGAGACGACAGACACAATTTGGATGAGGGCAAGGAAACGGCT
GTATATTTTTAGTTAGAGCGCGTAACGCAAAGCTTTCTTTCAATTTATCA
AAACAAATATAAAAAAAGTACATAAATAAAAAAAAAAAAAAAAAAA

IP15694.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG34456-RA 627 CG34456-RA 1..627 1..627 3135 100 Plus
Klp67A-RA 3012 Klp67A-RA 2893..3012 630..511 600 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9354026..9354651 1..627 2980 98.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:25:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9362108..9362737 1..630 3150 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9355208..9355837 1..630 3150 100 Plus
Blast to na_te.dros performed 2019-03-16 09:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy8 4955 gypsy8 GYPSY8 4955bp 3803..3869 3..70 112 64.7 Plus

IP15694.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:37:46 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9354026..9354651 1..627 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:59:59 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
CG34456-RA 1..504 59..562 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:58:08 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
CG34456-RA 1..504 59..562 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:51:02 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
CG34456-RA 1..504 59..562 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:39:20 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
CG34456-RA 1..504 59..562 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:14:58 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
CG34456-RA 1..504 59..562 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:39:13 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
CG34456-RA 1..627 1..627 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:58:08 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
CG34456-RA 1..627 1..627 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:51:02 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
CG34456-RA 1..627 1..627 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:39:22 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
CG34456-RA 1..627 1..627 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:14:58 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
CG34456-RA 1..627 1..627 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:37:46 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9362108..9362734 1..627 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:37:46 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9362108..9362734 1..627 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:37:46 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9362108..9362734 1..627 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:51:02 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9355208..9355834 1..627 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:17:35 Download gff for IP15694.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9355208..9355834 1..627 100   Plus

IP15694.hyp Sequence

Translation from 0 to 561

> IP15694.hyp
NKWLYKIAAGQSGKNKPVDMWLSLIFIACLAGASSGDEKIPVEQGFVPRY
TPVAESKRQDLDLPADVGIEQQKRPAAGDKKPWRRVQYGYDGVPTAAWAA
PSPPAAILSILNPLLAPGLLLLGVNLGALLYMLLGLLGLAPYRSGSASRL
ASHPETNSQFWPCDQSFYHRDDRHNLDEGKETAVYF*

IP15694.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG34456-PA 167 CG34456-PA 1..167 20..186 885 100 Plus

IP15694.pep Sequence

Translation from 1 to 561

> IP15694.pep
NKWLYKIAAGQSGKNKPVDMWLSLIFIACLAGASSGDEKIPVEQGFVPRY
TPVAESKRQDLDLPADVGIEQQKRPAAGDKKPWRRVQYGYDGVPTAAWAA
PSPPAAILSILNPLLAPGLLLLGVNLGALLYMLLGLLGLAPYRSGSASRL
ASHPETNSQFWPCDQSFYHRDDRHNLDEGKETAVYF*

IP15694.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10685-PA 161 GF10685-PA 1..161 20..186 304 66.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15363-PA 174 GG15363-PA 1..174 20..186 504 85.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG34456-PA 167 CG34456-PA 1..167 20..186 885 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27371-PA 302 GL27371-PA 143..302 16..186 207 52.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:45:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24284-PA 156 GA24284-PA 1..156 20..186 203 52.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:45:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25135-PA 171 GM25135-PA 1..171 20..186 571 93 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11143-PA 157 GD11143-PA 1..154 20..169 462 89.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:45:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20826-PA 170 GE20826-PA 1..170 20..186 522 85.4 Plus