Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
IP15694.complete Sequence
646 bp (646 high quality bases) assembled on 2006-03-22
GenBank Submission: BT024953
> IP15694.complete
CAACAAGTGGCTATATAAGATTGCAGCCGGCCAGTCGGGAAAAAACAAAC
CCGTAGATATGTGGCTGTCGCTTATCTTTATTGCCTGTCTAGCCGGCGCA
AGCAGTGGCGACGAGAAGATCCCGGTGGAGCAGGGATTTGTGCCCCGCTA
CACTCCGGTGGCCGAGAGCAAGCGACAGGATCTGGATTTACCCGCTGACG
TAGGCATCGAGCAGCAAAAGAGACCTGCTGCAGGCGATAAGAAACCCTGG
CGACGAGTGCAGTACGGATACGATGGAGTGCCGACTGCTGCCTGGGCTGC
TCCATCTCCACCAGCTGCCATACTGTCCATCCTGAATCCTCTGCTTGCAC
CGGGATTGCTTCTTTTGGGTGTGAATTTGGGAGCCCTGCTGTACATGCTG
CTGGGACTCCTGGGCTTGGCTCCTTATCGCAGTGGCAGCGCCAGTCGGTT
AGCCTCGCATCCGGAAACCAACTCCCAATTCTGGCCGTGCGATCAAAGCT
TCTACCACCGAGACGACAGACACAATTTGGATGAGGGCAAGGAAACGGCT
GTATATTTTTAGTTAGAGCGCGTAACGCAAAGCTTTCTTTCAATTTATCA
AAACAAATATAAAAAAAGTACATAAATAAAAAAAAAAAAAAAAAAA
IP15694.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:34:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34456-RA | 627 | CG34456-RA | 1..627 | 1..627 | 3135 | 100 | Plus |
Klp67A-RA | 3012 | Klp67A-RA | 2893..3012 | 630..511 | 600 | 100 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:36:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 9354026..9354651 | 1..627 | 2980 | 98.7 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:25:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:36:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 9362108..9362737 | 1..630 | 3150 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 9355208..9355837 | 1..630 | 3150 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 09:36:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
gypsy8 | 4955 | gypsy8 GYPSY8 4955bp | 3803..3869 | 3..70 | 112 | 64.7 | Plus |
IP15694.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:37:46 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 9354026..9354651 | 1..627 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:59:59 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34456-RA | 1..504 | 59..562 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:58:08 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34456-RA | 1..504 | 59..562 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:51:02 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34456-RA | 1..504 | 59..562 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:39:20 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34456-RA | 1..504 | 59..562 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:14:58 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34456-RA | 1..504 | 59..562 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:39:13 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34456-RA | 1..627 | 1..627 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:58:08 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34456-RA | 1..627 | 1..627 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:51:02 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34456-RA | 1..627 | 1..627 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:39:22 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34456-RA | 1..627 | 1..627 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:14:58 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34456-RA | 1..627 | 1..627 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:37:46 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 9362108..9362734 | 1..627 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:37:46 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 9362108..9362734 | 1..627 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:37:46 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 9362108..9362734 | 1..627 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:51:02 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 9355208..9355834 | 1..627 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:17:35 Download gff for
IP15694.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 9355208..9355834 | 1..627 | 100 | | Plus |
IP15694.hyp Sequence
Translation from 0 to 561
> IP15694.hyp
NKWLYKIAAGQSGKNKPVDMWLSLIFIACLAGASSGDEKIPVEQGFVPRY
TPVAESKRQDLDLPADVGIEQQKRPAAGDKKPWRRVQYGYDGVPTAAWAA
PSPPAAILSILNPLLAPGLLLLGVNLGALLYMLLGLLGLAPYRSGSASRL
ASHPETNSQFWPCDQSFYHRDDRHNLDEGKETAVYF*
IP15694.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:20:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34456-PA | 167 | CG34456-PA | 1..167 | 20..186 | 885 | 100 | Plus |
IP15694.pep Sequence
Translation from 1 to 561
> IP15694.pep
NKWLYKIAAGQSGKNKPVDMWLSLIFIACLAGASSGDEKIPVEQGFVPRY
TPVAESKRQDLDLPADVGIEQQKRPAAGDKKPWRRVQYGYDGVPTAAWAA
PSPPAAILSILNPLLAPGLLLLGVNLGALLYMLLGLLGLAPYRSGSASRL
ASHPETNSQFWPCDQSFYHRDDRHNLDEGKETAVYF*
IP15694.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:45:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10685-PA | 161 | GF10685-PA | 1..161 | 20..186 | 304 | 66.7 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:45:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15363-PA | 174 | GG15363-PA | 1..174 | 20..186 | 504 | 85.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34456-PA | 167 | CG34456-PA | 1..167 | 20..186 | 885 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:45:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL27371-PA | 302 | GL27371-PA | 143..302 | 16..186 | 207 | 52.2 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:45:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA24284-PA | 156 | GA24284-PA | 1..156 | 20..186 | 203 | 52.3 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:45:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25135-PA | 171 | GM25135-PA | 1..171 | 20..186 | 571 | 93 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:45:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD11143-PA | 157 | GD11143-PA | 1..154 | 20..169 | 462 | 89.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:45:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE20826-PA | 170 | GE20826-PA | 1..170 | 20..186 | 522 | 85.4 | Plus |