Clone IP15696 Report

Search the DGRC for IP15696

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:156
Well:96
Vector:pOT2
Associated Gene/TranscriptArpc3A-RD
Protein status:IP15696.pep:
Sequenced Size:1041

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Arpc3A 2008-04-29 Release 5.5 accounting
Arpc3A 2008-08-15 Release 5.9 accounting
Arpc3A 2008-12-18 5.12 accounting

Clone Sequence Records

IP15696.complete Sequence

1041 bp (1041 high quality bases) assembled on 2005-11-21

GenBank Submission: BT024265

> IP15696.complete
AAAATTTGTAAACAGTGGACGCCTATACTTAAAAACAATATTTAACATCG
AAAAAATAACGTTTTCAACGTTAATTTAAATAATTAATTTAAAATACAAT
TCAACATGCCGGTTAGTGGATACTTGCGCATCGATGCGCAAGTATCCACT
AACGCCAACTCGTTTGCCTTTAAAGGCAAACGAGTTGGCGTTGGTTAGTG
GATACTTGCGCAAAGGCAAACGAGTTGGCGTTGAGATATTCCCAGTTCTT
TTCACCTGCTTTCGTGACCCCCTGCCAAGCATAAAAATTTCCAAGGGAAA
AGGCAATCTTGTAAATTAACTATGCTTTCAGGCCTACCACTCGCAGATCA
AGGAAGTGCGCCAGCAGGTGGGCAACATGGCCATCCTGCCGCTGAGGACG
CAGGTGCGCGGGCCAGCGCCCAGTGCGAATATTGAGAGCGACATCATTGA
TGAGTCACTGTACTACTTCAAAGCCAATGTCTTCTTTCGCACGTACGAAA
TCAAGTCCGACGTGGATCGCGTGCTCATCTATGTGACGCTCTACATAACA
GAGTGCCTCAAGAAGCTCAATCGCTCCACGAGCAAGGCCCAGGGACAGCA
GGACATGTACAGCCTGGCCATCTCCAAGTTCGACATTCCCGGCGATGCTG
GCTTCCCATTGAACGCCGTCTATGCCAAGCCGCAAACGGCCCAGGATGCG
GATCTGATGCGCCAGTACCTGCTGCAGCTGCGCCACGAAACCGGCAACCG
GGTACTGGAGAAGGTCTTCAACACCGAGGATGGCAAGCCCAATAAATGGT
GGACCTGCTTCGCGAAGAAAAAGTTCATGGAGAAGAGTCTGGCTGGACCT
GGACAATAAACAGCTATCCACAATATCTGGTATCTTGTTTTGCTTCTACG
ACGGGTAAAAATACCCTTCAATTAAGTTTTACTCGCAGCGTGGTCCTAAT
TTGCAGTATCACTGCCAACGTGTCACAATTAATTAAATTCATTAACCACT
AAATAAATTATTTGAATTTGTAAAAAAAAAAAAAAAAAAAA

IP15696.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc3A-RD 1058 Arpc3A-RD 130..963 193..1023 4100 99.6 Plus
Arpc3A-RC 1064 Arpc3A-RC 152..844 331..1023 3465 100 Plus
Arpc3A-RD 1058 Arpc3A-RD 20..151 1..132 645 99.2 Plus
Arpc3A-RC 1064 Arpc3A-RC 42..153 1..112 545 99.1 Plus
Arpc3B-RA 733 Arpc3B-RA 477..637 693..853 310 79.5 Plus
Arpc3B-RA 733 Arpc3B-RA 160..339 367..546 240 75.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11659804..11660321 504..1021 2590 100 Plus
chr3R 27901430 chr3R 11659380..11659695 193..505 1485 98.7 Plus
chr3R 27901430 chr3R 11659270..11659396 1..127 635 100 Plus
chrX 22417052 chrX 16994178..16994338 853..693 325 80.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:25:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15835195..15835714 504..1023 2600 100 Plus
3R 32079331 3R 15834771..15835086 193..505 1500 99.1 Plus
3R 32079331 3R 15834661..15834792 1..132 645 99.2 Plus
X 23542271 X 17104648..17104808 853..693 310 79.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15576026..15576545 504..1023 2600 100 Plus
3R 31820162 3R 15575602..15575917 193..505 1510 99 Plus
3R 31820162 3R 15575492..15575623 1..132 645 99.2 Plus
X 23527363 X 17112746..17112906 853..693 310 79.5 Minus
X 23527363 X 17113587..17113719 499..367 155 74.4 Minus
Blast to na_te.dros performed on 2019-03-15 15:30:43 has no hits.

IP15696.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:31:55 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11659380..11659695 193..505 99 -> Plus
chr3R 11659806..11660321 506..1021 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:00:00 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RB 56..573 341..859 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:45:49 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 2..534 328..859 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:31:01 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 2..534 328..859 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:27:18 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RB 56..573 341..859 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:08:31 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 2..534 328..859 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:19:05 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RB 56..573 341..859 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:45:49 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RD 1..103 8..110 99 == Plus
Arpc3A-RD 104..935 193..1021 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:31:01 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 119..814 322..1021 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:27:18 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RB 56..573 341..859 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:08:31 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc3A-RC 119..814 322..1021 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:31:55 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15834771..15835086 193..505 99 -> Plus
3R 15835197..15835712 506..1021 100   Plus
3R 15834661..15834770 1..110 99 == Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:31:55 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15834771..15835086 193..505 99 -> Plus
3R 15835197..15835712 506..1021 100   Plus
3R 15834661..15834770 1..110 99 == Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:31:55 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15834771..15835086 193..505 99 -> Plus
3R 15835197..15835712 506..1021 100   Plus
3R 15834661..15834770 1..110 99 == Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:31:01 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11660383..11660492 1..110 99 == Plus
arm_3R 11660493..11660808 193..505 99 -> Plus
arm_3R 11660919..11661434 506..1021 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:06:26 Download gff for IP15696.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15575602..15575917 193..505 99 -> Plus
3R 15576028..15576543 506..1021 100   Plus
3R 15575492..15575601 1..110 99 == Plus

IP15696.hyp Sequence

Translation from 294 to 776

> IP15696.hyp
MAILPLRTQVRGPAPSANIESDIIDESLYYFKANVFFRTYEIKSDVDRVL
IYVTLYITECLKKLNRSTSKAQGQQDMYSLAISKFDIPGDAGFPLNAVYA
KPQTAQDADLMRQYLLQLRHETGNRVLEKVFNTEDGKPNKWWTCFAKKKF
MEKSLAGPGQ*

IP15696.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc3A-PE 177 CG4560-PE 18..177 1..160 834 100 Plus
Arpc3A-PC 177 CG4560-PC 18..177 1..160 834 100 Plus
Arpc3B-PC 157 CG8936-PC 1..156 1..159 666 76.1 Plus
Arpc3B-PB 157 CG8936-PB 1..156 1..159 666 76.1 Plus
Arpc3B-PA 174 CG8936-PA 18..173 1..159 666 76.1 Plus

IP15696.pep Sequence

Translation from 376 to 858

> IP15696.pep
MAILPLRTQVRGPAPSANIESDIIDESLYYFKANVFFRTYEIKSDVDRVL
IYVTLYITECLKKLNRSTSKAQGQQDMYSLAISKFDIPGDAGFPLNAVYA
KPQTAQDADLMRQYLLQLRHETGNRVLEKVFNTEDGKPNKWWTCFAKKKF
MEKSLAGPGQ*

IP15696.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18546-PA 177 GF18546-PA 18..177 1..160 818 92.5 Plus
Dana\GF21827-PA 157 GF21827-PA 1..156 1..159 697 76.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16957-PA 177 GG16957-PA 18..177 1..160 859 99.4 Plus
Dere\GG18204-PA 172 GG18204-PA 18..172 1..158 586 67.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19295-PA 177 GH19295-PA 18..177 1..160 813 91.2 Plus
Dgri\GH24637-PA 174 GH24637-PA 18..174 1..160 706 79.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc3A-PE 177 CG4560-PE 18..177 1..160 834 100 Plus
Arpc3A-PC 177 CG4560-PC 18..177 1..160 834 100 Plus
Arpc3B-PC 157 CG8936-PC 1..156 1..159 666 76.1 Plus
Arpc3B-PB 157 CG8936-PB 1..156 1..159 666 76.1 Plus
Arpc3B-PA 174 CG8936-PA 18..173 1..159 666 76.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23512-PA 177 GI23512-PA 18..177 1..160 804 90 Plus
Dmoj\GI15826-PA 173 GI15826-PA 18..173 1..159 674 77.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22074-PA 177 GL22074-PA 18..177 1..160 823 93.1 Plus
Dper\GL18294-PA 157 GL18294-PA 1..156 1..159 644 73.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27369-PA 177 GA27369-PA 18..177 1..160 823 93.1 Plus
Dpse\GA27398-PA 157 GA27398-PA 1..156 1..159 644 73.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24264-PA 177 GM24264-PA 18..177 1..160 862 100 Plus
Dsec\GM13341-PA 137 GM13341-PA 18..136 1..122 499 73.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19052-PA 177 GD19052-PA 18..177 1..160 862 100 Plus
Dsim\GD15703-PA 174 GD15703-PA 18..173 1..159 683 76.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10263-PA 177 GJ10263-PA 18..177 1..160 814 91.2 Plus
Dvir\GJ18679-PA 174 GJ18679-PA 18..174 1..160 701 79.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12788-PA 178 GK12788-PA 18..178 1..160 789 91.3 Plus
Dwil\GK17662-PA 174 GK17662-PA 18..173 1..159 661 74.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24343-PA 177 GE24343-PA 18..177 1..160 859 99.4 Plus
Dyak\GE15621-PA 174 GE15621-PA 18..173 1..159 691 76.7 Plus