Clone IP15859 Report

Search the DGRC for IP15859

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:158
Well:59
Vector:pOT2
Associated Gene/TranscriptCG33170-RB
Protein status:IP15859.pep: gold
Sequenced Size:623

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33169 2008-04-29 Release 5.5 accounting
CG33170 2008-08-15 Release 5.9 accounting
CG33170 2008-12-18 5.12 accounting

Clone Sequence Records

IP15859.complete Sequence

623 bp (623 high quality bases) assembled on 2006-01-13

GenBank Submission: BT024253

> IP15859.complete
CTCGTCGTCGGTGACCGCAAACTAATAATTGTTAATACATATGCATATGC
ATGTACATAAATTGAAGTAAAAGTTCAGTGCTCGAAAGGCAGTAACTTAA
CTCCATAGTTATCAGAGTCAGCCAAATACGATTACCTAACCATACAAACA
CAAATCGCAGTGGGCCAGTCAGCTGTTTTCAGATTCCGAGCAGCTGCAGA
CGAAGCGCCGAAGCAGCGTCGTTTGACGTTTCTTTTTCACATTCTCTCAC
TTTTGCTAAGACTCTCACGCTGGCGGCTGCGGGTGACAAAGGCTCCTTTA
ACTATTCCACTATGCTCAAGTTTCTGTTAACTTTTGGCGCCGGGGTGTAT
ACGGGAATCTATGTCTCACAGAACTATGAGGTCCCCCGAGTGGATGATCC
CCAGAAGTTGATGCAGCGTTTCAACGAGAAACTCAAAGAACTAATGGATC
AAACCAAGAACAAATCGCCCGGCGAGAAACTAGTGGATGACATCAAAAAG
GAGGCCAAGAAGATACTAGACGACTGACTGGCGGAATAAGACCACAATTT
TAGTTTAAACCAATTTATCTATGATCAAATAAAGAGAATCTATATGTGTA
AAAAAAAAAAAAAAAAAAAAAAA

IP15859.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG33170-RB 704 CG33170-RB 104..704 1..601 3005 100 Plus
nc_14230.a 631 nc_14230.a 86..411 1..326 1630 100 Plus
CG11137-RA 840 CG11137-RA 715..840 603..478 630 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22853516..22853850 1..335 1645 99.4 Plus
chr3L 24539361 chr3L 22856311..22856451 459..599 690 99.3 Plus
chr3L 24539361 chr3L 22854792..22854876 379..463 425 100 Plus
chr3L 24539361 chr3L 22854686..22854742 326..382 285 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:26:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22864600..22864934 1..335 1645 99.4 Plus
3L 28110227 3L 22867395..22867539 459..603 710 99.3 Plus
3L 28110227 3L 22865876..22865960 379..463 425 100 Plus
3L 28110227 3L 22865770..22865826 326..382 285 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22857700..22858034 1..335 1645 99.4 Plus
3L 28103327 3L 22860495..22860639 459..603 710 99.3 Plus
3L 28103327 3L 22858976..22859060 379..463 425 100 Plus
3L 28103327 3L 22858870..22858926 326..382 285 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:06:31 has no hits.

IP15859.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:07:36 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22853516..22853841 1..326 100 -> Plus
chr3L 22854687..22854740 327..380 100 -> Plus
chr3L 22854794..22854876 381..463 100 -> Plus
chr3L 22856316..22856451 464..599 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:00:37 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
CG33170-RB 1..216 312..527 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:39:12 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
CG33170-RB 1..216 312..527 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:15:47 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
CG33170-RB 1..216 312..527 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:14:26 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
CG33170-RB 1..216 312..527 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:14:04 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
CG33170-RB 1..216 312..527 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:11:15 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
CG33170-RB 1..599 1..599 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:39:12 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
CG33170-RB 1..599 1..599 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:15:47 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
CG33170-RB 1..599 1..599 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:14:26 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
CG33170-RB 1..599 1..599 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:14:04 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
CG33170-RB 1..599 1..599 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:07:36 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22865878..22865960 381..463 100 -> Plus
3L 22867400..22867535 464..599 100   Plus
3L 22864600..22864925 1..326 100 -> Plus
3L 22865771..22865824 327..380 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:07:36 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22865878..22865960 381..463 100 -> Plus
3L 22867400..22867535 464..599 100   Plus
3L 22864600..22864925 1..326 100 -> Plus
3L 22865771..22865824 327..380 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:07:36 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22865878..22865960 381..463 100 -> Plus
3L 22867400..22867535 464..599 100   Plus
3L 22864600..22864925 1..326 100 -> Plus
3L 22865771..22865824 327..380 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:15:47 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22857700..22858025 1..326 100 -> Plus
arm_3L 22858871..22858924 327..380 100 -> Plus
arm_3L 22858978..22859060 381..463 100 -> Plus
arm_3L 22860500..22860635 464..599 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:01:57 Download gff for IP15859.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22857700..22858025 1..326 100 -> Plus
3L 22858871..22858924 327..380 100 -> Plus
3L 22858978..22859060 381..463 100 -> Plus
3L 22860500..22860635 464..599 100   Plus

IP15859.pep Sequence

Translation from 311 to 526

> IP15859.pep
MLKFLLTFGAGVYTGIYVSQNYEVPRVDDPQKLMQRFNEKLKELMDQTKN
KSPGEKLVDDIKKEAKKILDD*

IP15859.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11003-PA 121 GF11003-PA 51..121 1..71 293 77.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16282-PA 98 GG16282-PA 53..98 6..51 237 95.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16772-PA 70 GH16772-PA 1..70 1..71 276 76.1 Plus
Dgri\GH16774-PA 93 GH16774-PA 48..92 5..49 174 68.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG33170-PC 71 CG33170-PC 1..71 1..71 364 100 Plus
CG33170-PB 71 CG33170-PB 1..71 1..71 364 100 Plus
CG33170-PA 98 CG33170-PA 53..98 6..51 240 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13433-PA 91 GI13433-PA 48..91 6..49 181 72.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24971-PA 71 GL24971-PA 6..71 6..71 276 77.3 Plus
Dper\GL25182-PA 99 GL25182-PA 53..99 5..51 193 72.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17339-PA 119 GA17339-PA 53..119 5..71 278 77.6 Plus
Dpse\GA23715-PA 99 GA23715-PA 53..99 5..51 192 72.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22475-PA 98 GM22475-PA 53..98 6..51 241 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15056-PA 98 GD15056-PA 53..98 6..51 241 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11795-PA 91 GJ11795-PA 43..91 1..49 182 67.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20394-PA 123 GK20394-PA 57..123 5..71 287 79.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22644-PA 98 GE22644-PA 53..98 6..51 236 95.7 Plus

IP15859.hyp Sequence

Translation from 311 to 526

> IP15859.hyp
MLKFLLTFGAGVYTGIYVSQNYEVPRVDDPQKLMQRFNEKLKELMDQTKN
KSPGEKLVDDIKKEAKKILDD*

IP15859.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG33170-PC 71 CG33170-PC 1..71 1..71 364 100 Plus
CG33170-PB 71 CG33170-PB 1..71 1..71 364 100 Plus
CG33170-PA 98 CG33170-PA 53..98 6..51 240 100 Plus