BDGP Sequence Production Resources |
Search the DGRC for IP15859
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 158 |
Well: | 59 |
Vector: | pOT2 |
Associated Gene/Transcript | CG33170-RB |
Protein status: | IP15859.pep: gold |
Sequenced Size: | 623 |
Gene | Date | Evidence |
---|---|---|
CG33169 | 2008-04-29 | Release 5.5 accounting |
CG33170 | 2008-08-15 | Release 5.9 accounting |
CG33170 | 2008-12-18 | 5.12 accounting |
623 bp (623 high quality bases) assembled on 2006-01-13
GenBank Submission: BT024253
> IP15859.complete CTCGTCGTCGGTGACCGCAAACTAATAATTGTTAATACATATGCATATGC ATGTACATAAATTGAAGTAAAAGTTCAGTGCTCGAAAGGCAGTAACTTAA CTCCATAGTTATCAGAGTCAGCCAAATACGATTACCTAACCATACAAACA CAAATCGCAGTGGGCCAGTCAGCTGTTTTCAGATTCCGAGCAGCTGCAGA CGAAGCGCCGAAGCAGCGTCGTTTGACGTTTCTTTTTCACATTCTCTCAC TTTTGCTAAGACTCTCACGCTGGCGGCTGCGGGTGACAAAGGCTCCTTTA ACTATTCCACTATGCTCAAGTTTCTGTTAACTTTTGGCGCCGGGGTGTAT ACGGGAATCTATGTCTCACAGAACTATGAGGTCCCCCGAGTGGATGATCC CCAGAAGTTGATGCAGCGTTTCAACGAGAAACTCAAAGAACTAATGGATC AAACCAAGAACAAATCGCCCGGCGAGAAACTAGTGGATGACATCAAAAAG GAGGCCAAGAAGATACTAGACGACTGACTGGCGGAATAAGACCACAATTT TAGTTTAAACCAATTTATCTATGATCAAATAAAGAGAATCTATATGTGTA AAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 22853516..22853850 | 1..335 | 1645 | 99.4 | Plus |
chr3L | 24539361 | chr3L | 22856311..22856451 | 459..599 | 690 | 99.3 | Plus |
chr3L | 24539361 | chr3L | 22854792..22854876 | 379..463 | 425 | 100 | Plus |
chr3L | 24539361 | chr3L | 22854686..22854742 | 326..382 | 285 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 22864600..22864934 | 1..335 | 1645 | 99.4 | Plus |
3L | 28110227 | 3L | 22867395..22867539 | 459..603 | 710 | 99.3 | Plus |
3L | 28110227 | 3L | 22865876..22865960 | 379..463 | 425 | 100 | Plus |
3L | 28110227 | 3L | 22865770..22865826 | 326..382 | 285 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 22857700..22858034 | 1..335 | 1645 | 99.4 | Plus |
3L | 28103327 | 3L | 22860495..22860639 | 459..603 | 710 | 99.3 | Plus |
3L | 28103327 | 3L | 22858976..22859060 | 379..463 | 425 | 100 | Plus |
3L | 28103327 | 3L | 22858870..22858926 | 326..382 | 285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 22853516..22853841 | 1..326 | 100 | -> | Plus |
chr3L | 22854687..22854740 | 327..380 | 100 | -> | Plus |
chr3L | 22854794..22854876 | 381..463 | 100 | -> | Plus |
chr3L | 22856316..22856451 | 464..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33170-RB | 1..216 | 312..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33170-RB | 1..216 | 312..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33170-RB | 1..216 | 312..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33170-RB | 1..216 | 312..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33170-RB | 1..216 | 312..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33170-RB | 1..599 | 1..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33170-RB | 1..599 | 1..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33170-RB | 1..599 | 1..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33170-RB | 1..599 | 1..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33170-RB | 1..599 | 1..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22865878..22865960 | 381..463 | 100 | -> | Plus |
3L | 22867400..22867535 | 464..599 | 100 | Plus | |
3L | 22864600..22864925 | 1..326 | 100 | -> | Plus |
3L | 22865771..22865824 | 327..380 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22865878..22865960 | 381..463 | 100 | -> | Plus |
3L | 22867400..22867535 | 464..599 | 100 | Plus | |
3L | 22864600..22864925 | 1..326 | 100 | -> | Plus |
3L | 22865771..22865824 | 327..380 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22865878..22865960 | 381..463 | 100 | -> | Plus |
3L | 22867400..22867535 | 464..599 | 100 | Plus | |
3L | 22864600..22864925 | 1..326 | 100 | -> | Plus |
3L | 22865771..22865824 | 327..380 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 22857700..22858025 | 1..326 | 100 | -> | Plus |
arm_3L | 22858871..22858924 | 327..380 | 100 | -> | Plus |
arm_3L | 22858978..22859060 | 381..463 | 100 | -> | Plus |
arm_3L | 22860500..22860635 | 464..599 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22857700..22858025 | 1..326 | 100 | -> | Plus |
3L | 22858871..22858924 | 327..380 | 100 | -> | Plus |
3L | 22858978..22859060 | 381..463 | 100 | -> | Plus |
3L | 22860500..22860635 | 464..599 | 100 | Plus |
Translation from 311 to 526
> IP15859.pep MLKFLLTFGAGVYTGIYVSQNYEVPRVDDPQKLMQRFNEKLKELMDQTKN KSPGEKLVDDIKKEAKKILDD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11003-PA | 121 | GF11003-PA | 51..121 | 1..71 | 293 | 77.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16282-PA | 98 | GG16282-PA | 53..98 | 6..51 | 237 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16772-PA | 70 | GH16772-PA | 1..70 | 1..71 | 276 | 76.1 | Plus |
Dgri\GH16774-PA | 93 | GH16774-PA | 48..92 | 5..49 | 174 | 68.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33170-PC | 71 | CG33170-PC | 1..71 | 1..71 | 364 | 100 | Plus |
CG33170-PB | 71 | CG33170-PB | 1..71 | 1..71 | 364 | 100 | Plus |
CG33170-PA | 98 | CG33170-PA | 53..98 | 6..51 | 240 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13433-PA | 91 | GI13433-PA | 48..91 | 6..49 | 181 | 72.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24971-PA | 71 | GL24971-PA | 6..71 | 6..71 | 276 | 77.3 | Plus |
Dper\GL25182-PA | 99 | GL25182-PA | 53..99 | 5..51 | 193 | 72.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17339-PA | 119 | GA17339-PA | 53..119 | 5..71 | 278 | 77.6 | Plus |
Dpse\GA23715-PA | 99 | GA23715-PA | 53..99 | 5..51 | 192 | 72.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22475-PA | 98 | GM22475-PA | 53..98 | 6..51 | 241 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15056-PA | 98 | GD15056-PA | 53..98 | 6..51 | 241 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11795-PA | 91 | GJ11795-PA | 43..91 | 1..49 | 182 | 67.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20394-PA | 123 | GK20394-PA | 57..123 | 5..71 | 287 | 79.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22644-PA | 98 | GE22644-PA | 53..98 | 6..51 | 236 | 95.7 | Plus |
Translation from 311 to 526
> IP15859.hyp MLKFLLTFGAGVYTGIYVSQNYEVPRVDDPQKLMQRFNEKLKELMDQTKN KSPGEKLVDDIKKEAKKILDD*