Clone IP15980 Report

Search the DGRC for IP15980

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:159
Well:80
Vector:pOT2
Associated Gene/TranscriptCG42659-RB
Protein status:IP15980.pep: gold
Sequenced Size:364

Clone Sequence Records

IP15980.complete Sequence

364 bp assembled on 2011-03-10

GenBank Submission: BT126398.1

> IP15980.complete
TCTGGTCAAACATTTGTTTAAATTTCTCATTTTTCTCTTCCATTTCCGAC
TTCTTTCGAGTGCTGAAAATGGTTTACTTAAGTCGTCCTTGGACTCCGGC
CATAAACCCTTTCTACATTGGCCCCTATCCGAGATGCGCAGTATGTCCGT
GCAACTTCGACATTTACAAAGGATACACCCCCGGTGGCTGGCACAGTCGT
TGCTATAGCAGCTATTGACGAGACGAGTACCTGTATAAAATGCAAGAATA
ACGGCGGGAACAAATATAGTTGAACTTTGAAACTGCACACCAATTAGCCT
CGCACACATCTATGTAGAGAAATAATAAAATTGATTCATCGTCAAAAAAA
AAAAAAAAAAAAAA

IP15980.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:20:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18006192..18006487 48..343 1480 100 Plus
chr2L 23010047 chr2L 18006091..18006138 1..48 240 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:20:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18007547..18007843 48..344 1485 100 Plus
2L 23513712 2L 18007446..18007493 1..48 240 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18007547..18007843 48..344 1485 100 Plus
2L 23513712 2L 18007446..18007493 1..48 240 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:20:12 has no hits.

IP15980.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:21:10 Download gff for IP15980.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18006091..18006138 1..48 100 -> Plus
chr2L 18006193..18006487 49..343 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-10 09:19:04 Download gff for IP15980.complete
Subject Subject Range Query Range Percent Splice Strand
CG42659-RB 1..150 69..218 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:54:49 Download gff for IP15980.complete
Subject Subject Range Query Range Percent Splice Strand
CG42659-RB 1..150 69..218 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:27:11 Download gff for IP15980.complete
Subject Subject Range Query Range Percent Splice Strand
CG42659-RB 1..150 69..218 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-10 09:19:03 Download gff for IP15980.complete
Subject Subject Range Query Range Percent Splice Strand
CG42659-RB 87..429 1..343 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:54:49 Download gff for IP15980.complete
Subject Subject Range Query Range Percent Splice Strand
CG42659-RB 87..429 1..343 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:27:11 Download gff for IP15980.complete
Subject Subject Range Query Range Percent Splice Strand
CG42659-RB 87..429 1..343 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:10 Download gff for IP15980.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007446..18007493 1..48 100 -> Plus
2L 18007548..18007842 49..343 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:10 Download gff for IP15980.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007446..18007493 1..48 100 -> Plus
2L 18007548..18007842 49..343 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:10 Download gff for IP15980.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007446..18007493 1..48 100 -> Plus
2L 18007548..18007842 49..343 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:54:49 Download gff for IP15980.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18007446..18007493 1..48 100 -> Plus
arm_2L 18007548..18007842 49..343 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:59 Download gff for IP15980.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007548..18007842 49..343 100   Plus
2L 18007446..18007493 1..48 100 -> Plus

IP15980.hyp Sequence

Translation from 2 to 217

> IP15980.hyp
WSNICLNFSFFSSISDFFRVLKMVYLSRPWTPAINPFYIGPYPRCAVCPC
NFDIYKGYTPGGWHSRCYSSY*

IP15980.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG42659-PB 49 CG42659-PB 1..49 23..71 301 100 Plus

IP15980.pep Sequence

Translation from 2 to 217

> IP15980.pep
WSNICLNFSFFSSISDFFRVLKMVYLSRPWTPAINPFYIGPYPRCAVCPC
NFDIYKGYTPGGWHSRCYSSY*

IP15980.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG42659-PB 49 CG42659-PB 1..49 23..71 301 100 Plus