IP15980.complete Sequence
364 bp assembled on 2011-03-10
GenBank Submission: BT126398.1
> IP15980.complete
TCTGGTCAAACATTTGTTTAAATTTCTCATTTTTCTCTTCCATTTCCGAC
TTCTTTCGAGTGCTGAAAATGGTTTACTTAAGTCGTCCTTGGACTCCGGC
CATAAACCCTTTCTACATTGGCCCCTATCCGAGATGCGCAGTATGTCCGT
GCAACTTCGACATTTACAAAGGATACACCCCCGGTGGCTGGCACAGTCGT
TGCTATAGCAGCTATTGACGAGACGAGTACCTGTATAAAATGCAAGAATA
ACGGCGGGAACAAATATAGTTGAACTTTGAAACTGCACACCAATTAGCCT
CGCACACATCTATGTAGAGAAATAATAAAATTGATTCATCGTCAAAAAAA
AAAAAAAAAAAAAA
IP15980.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:20:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 18006192..18006487 | 48..343 | 1480 | 100 | Plus |
chr2L | 23010047 | chr2L | 18006091..18006138 | 1..48 | 240 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:20:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18007547..18007843 | 48..344 | 1485 | 100 | Plus |
2L | 23513712 | 2L | 18007446..18007493 | 1..48 | 240 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18007547..18007843 | 48..344 | 1485 | 100 | Plus |
2L | 23513712 | 2L | 18007446..18007493 | 1..48 | 240 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 22:20:12 has no hits.
IP15980.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:21:10 Download gff for
IP15980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 18006091..18006138 | 1..48 | 100 | -> | Plus |
chr2L | 18006193..18006487 | 49..343 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-10 09:19:04 Download gff for
IP15980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42659-RB | 1..150 | 69..218 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:54:49 Download gff for
IP15980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42659-RB | 1..150 | 69..218 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:27:11 Download gff for
IP15980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42659-RB | 1..150 | 69..218 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-10 09:19:03 Download gff for
IP15980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42659-RB | 87..429 | 1..343 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:54:49 Download gff for
IP15980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42659-RB | 87..429 | 1..343 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:27:11 Download gff for
IP15980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42659-RB | 87..429 | 1..343 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:10 Download gff for
IP15980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18007446..18007493 | 1..48 | 100 | -> | Plus |
2L | 18007548..18007842 | 49..343 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:10 Download gff for
IP15980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18007446..18007493 | 1..48 | 100 | -> | Plus |
2L | 18007548..18007842 | 49..343 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:10 Download gff for
IP15980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18007446..18007493 | 1..48 | 100 | -> | Plus |
2L | 18007548..18007842 | 49..343 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:54:49 Download gff for
IP15980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18007446..18007493 | 1..48 | 100 | -> | Plus |
arm_2L | 18007548..18007842 | 49..343 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:59 Download gff for
IP15980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18007548..18007842 | 49..343 | 100 | | Plus |
2L | 18007446..18007493 | 1..48 | 100 | -> | Plus |
IP15980.hyp Sequence
Translation from 2 to 217
> IP15980.hyp
WSNICLNFSFFSSISDFFRVLKMVYLSRPWTPAINPFYIGPYPRCAVCPC
NFDIYKGYTPGGWHSRCYSSY*
IP15980.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42659-PB | 49 | CG42659-PB | 1..49 | 23..71 | 301 | 100 | Plus |
IP15980.pep Sequence
Translation from 2 to 217
> IP15980.pep
WSNICLNFSFFSSISDFFRVLKMVYLSRPWTPAINPFYIGPYPRCAVCPC
NFDIYKGYTPGGWHSRCYSSY*
IP15980.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42659-PB | 49 | CG42659-PB | 1..49 | 23..71 | 301 | 100 | Plus |