BDGP Sequence Production Resources |
Search the DGRC for IP16036
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 160 |
Well: | 36 |
Vector: | pOT2 |
Associated Gene/Transcript | Zasp66-RK |
Protein status: | IP16036.pep: gold |
Sequenced Size: | 1652 |
Gene | Date | Evidence |
---|---|---|
CG6416 | 2008-04-29 | Release 5.5 accounting |
CG6416 | 2008-08-15 | Release 5.9 accounting |
CG6416 | 2008-12-18 | 5.12 accounting |
1652 bp (1652 high quality bases) assembled on 2006-09-20
GenBank Submission: BT029127
> IP16036.complete CGATCGAACAAAACGCTTAACGGATTGCAATCGCGCGCCGCCTGCGGCTC GGCCAGAAAAGGCCAGAAAAAAAAATAAACAATAAAAAATAAATATATAT TTTCGGGATAAACCATCGCTGGATCGGATGAGCGTCTGATCTTCCAGTCT ATCTTCAACATCAGGATGAGCCCCAAGCTGCATGAGTTTGCGGTGGTGCT ACTGCGCGATGGTCAGGCCACGCCCTGGGGCATTCGTTTGGTGGGCGGCA ACGATCTGGACACGCCGCTAATTATCACCAGGGTGCAAGTGGGCAGCCCA GCGCATGGCGAACTTCTAAGAGGCGACATCATCTCGAAGATCGGCGAGTA CGACGCACGCGACCTGAGTCATGCGGATGCACAGCAGCTGTTCCGCGGCG CTGGCAACGAGATCCGCCTGGTGGTGCACAGGGACAACAAAATCGCCTAC ACGCAGGGTGCAACTCAGGAGGCAGGTCCTGGATCTCGGAGCAACTCCAC TTTGCCGCCGGTCACTCCGGATCTGATGCCCCACCGCGGTCCGTCGCCCT TTTTGCCCGGACCCAGCCACTTTGAGAGGGCCCTCCAGTTGCCGGTGGAC ACGTTGCCGCAGACCGTGTTTCCCCAGCTGAACTCATCCGGTGGCTATGA GGTGCCATCGACTGTGTTCTCACCCAAGCCAACCAGGGACCATCAACAAG ACGTCGATGAGGAGCAGGCGGCCATTGTGAATCAGCCCTACCGTACAACT CCGCTGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGA GTCCTACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGAC ACGACTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTG CACAAGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCA ATTCAACTCGCCCATTGGCCTGTACTCCAACAACAACATCGAGGACACCA TCAGATCCACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAAC AGCGAAACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGG CCAATCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATC AGCCCAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCC CGGCCGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAG CGGCTCCTTCAATCGTCTCATGTACAGCGTGATTGGTGCCACCGAGTACT AGAAAGTGCAGCTGCAACACCAGCGACAGCAGCAACATCAACATCAACGC AACATCGGCAACATCTGCTGCACTTGTTTTATCTCCTAACATATTTAGCG GATTTTTATGAAATTCTGTTTAACTTACTCAATAAATTATATGAAGAACG ACAAGAAATTGTGAACCACTAACAAGCTTGATGATATAATGGATTGGTAA TCAATTGGCATCGAAATAAATTTACGATATAAACACCACTTAACGCCGCC TCAACCTAATTACTGTCTGCATATCCAATAGAAAACGTATATAAATTAAT TAAATAAAAAAAAAAGGAAAGTAAAAAAAAAAAAAAAAAAAAAAAAAAAA AA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Zasp66-RK | 1826 | Zasp66-RK | 21..1646 | 1..1626 | 8115 | 99.9 | Plus |
Zasp66-RF | 1898 | Zasp66-RF | 21..1038 | 1..1018 | 5090 | 100 | Plus |
Zasp66-RM | 1691 | Zasp66-RM | 21..1038 | 1..1018 | 5090 | 100 | Plus |
Zasp66-RF | 1898 | Zasp66-RF | 1109..1718 | 1017..1626 | 3035 | 99.8 | Plus |
Zasp66-RM | 1691 | Zasp66-RM | 1108..1558 | 1176..1626 | 2240 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 8630302..8630700 | 1216..1614 | 1965 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 8619449..8619755 | 429..735 | 1535 | 100 | Plus |
chr3L | 24539361 | chr3L | 8618254..8618537 | 1..284 | 1420 | 100 | Plus |
chr3L | 24539361 | chr3L | 8626611..8626816 | 733..938 | 1015 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 8629474..8629633 | 1017..1176 | 800 | 100 | Plus |
chr3L | 24539361 | chr3L | 8618985..8619135 | 282..432 | 755 | 100 | Plus |
chr3L | 24539361 | chr3L | 8627036..8627112 | 940..1016 | 370 | 98.7 | Plus |
chr3L | 24539361 | chr3L | 8630190..8630233 | 1175..1218 | 220 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 8638267..8638677 | 1216..1626 | 2040 | 99.8 | Plus |
3L | 28110227 | 3L | 8627424..8627730 | 429..735 | 1535 | 100 | Plus |
3L | 28110227 | 3L | 8626229..8626512 | 1..284 | 1420 | 100 | Plus |
3L | 28110227 | 3L | 8634580..8634785 | 733..938 | 1030 | 100 | Plus |
3L | 28110227 | 3L | 8637439..8637598 | 1017..1176 | 800 | 100 | Plus |
3L | 28110227 | 3L | 8626960..8627110 | 282..432 | 755 | 100 | Plus |
3L | 28110227 | 3L | 8635002..8635081 | 937..1016 | 400 | 100 | Plus |
3L | 28110227 | 3L | 8638155..8638198 | 1175..1218 | 220 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 8631367..8631777 | 1216..1626 | 2040 | 99.7 | Plus |
3L | 28103327 | 3L | 8620524..8620830 | 429..735 | 1535 | 100 | Plus |
3L | 28103327 | 3L | 8619329..8619612 | 1..284 | 1420 | 100 | Plus |
3L | 28103327 | 3L | 8627680..8627885 | 733..938 | 1030 | 100 | Plus |
3L | 28103327 | 3L | 8630539..8630698 | 1017..1176 | 800 | 100 | Plus |
3L | 28103327 | 3L | 8620060..8620210 | 282..432 | 755 | 100 | Plus |
3L | 28103327 | 3L | 8628102..8628181 | 937..1016 | 400 | 100 | Plus |
3L | 28103327 | 3L | 8631255..8631298 | 1175..1218 | 220 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6828..6890 | 1304..1365 | 186 | 79.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2295..2371 | 1296..1372 | 177 | 73.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6721..6804 | 1293..1372 | 167 | 70.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 1512..1587 | 1303..1371 | 166 | 73.7 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6722..6783 | 1309..1372 | 162 | 76.9 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6798..6879 | 1295..1372 | 157 | 69.5 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2761..2840 | 1295..1373 | 155 | 71.1 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1083..1154 | 1295..1365 | 150 | 69.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6753..6825 | 1304..1372 | 148 | 71.2 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1092..1273 | 1295..1465 | 148 | 59.1 | Plus |
Dvir\Het-A | 6610 | Dvir\Het-A HETAVIR 6610bp | 3280..3345 | 1304..1368 | 147 | 71.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2340..2404 | 1309..1372 | 142 | 70.8 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6774..6839 | 1304..1365 | 140 | 72.7 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2789..2854 | 1308..1372 | 138 | 69.7 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6794..6855 | 1309..1372 | 135 | 70.3 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2383..2461 | 1295..1372 | 133 | 67.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2632..2665 | 1310..1343 | 125 | 85.3 | Plus |
Doc3-element | 4740 | Doc3-element DOC3 4740bp | 528..577 | 1300..1352 | 123 | 73.6 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2418..2484 | 1290..1362 | 117 | 67.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 1541..1581 | 1308..1348 | 115 | 75.6 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2602..2665 | 1295..1354 | 112 | 68.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 8618986..8619134 | 283..431 | 100 | -> | Plus |
chr3L | 8619452..8619755 | 432..735 | 100 | -> | Plus |
chr3L | 8626614..8626814 | 736..936 | 99 | -> | Plus |
chr3L | 8627033..8627112 | 937..1016 | 97 | -> | Plus |
chr3L | 8629474..8629633 | 1017..1176 | 100 | -> | Plus |
chr3L | 8630192..8630230 | 1177..1215 | 100 | -> | Plus |
chr3L | 8630302..8630393 | 1216..1307 | 100 | == | Plus |
chr3L | 8630460..8630673 | 1374..1587 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6416-RF | 1..851 | 166..1016 | 100 | <- | Plus |
CG6416-RF | 922..1209 | 1017..1302 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RK | 1..1137 | 166..1302 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RK | 1..1137 | 166..1302 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6416-RF | 1..851 | 166..1016 | 100 | <- | Plus |
CG6416-RF | 922..1209 | 1017..1302 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RK | 1..1137 | 166..1302 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6416-RF | 21..1036 | 1..1016 | 100 | <- | Plus |
CG6416-RF | 1107..1697 | 1017..1605 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RK | 21..1625 | 1..1605 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RK | 21..1625 | 1..1605 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6416-RF | 21..1036 | 1..1016 | 100 | <- | Plus |
CG6416-RF | 1107..1697 | 1017..1605 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RK | 21..1625 | 1..1605 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8638267..8638656 | 1216..1605 | 99 | Plus | |
3L | 8626229..8626510 | 1..282 | 100 | -> | Plus |
3L | 8626961..8627109 | 283..431 | 100 | -> | Plus |
3L | 8627427..8627730 | 432..735 | 100 | -> | Plus |
3L | 8634583..8634783 | 736..936 | 100 | -> | Plus |
3L | 8635002..8635081 | 937..1016 | 100 | -> | Plus |
3L | 8637439..8637598 | 1017..1176 | 100 | -> | Plus |
3L | 8638157..8638195 | 1177..1215 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8638267..8638656 | 1216..1605 | 99 | Plus | |
3L | 8626229..8626510 | 1..282 | 100 | -> | Plus |
3L | 8626961..8627109 | 283..431 | 100 | -> | Plus |
3L | 8627427..8627730 | 432..735 | 100 | -> | Plus |
3L | 8634583..8634783 | 736..936 | 100 | -> | Plus |
3L | 8635002..8635081 | 937..1016 | 100 | -> | Plus |
3L | 8637439..8637598 | 1017..1176 | 100 | -> | Plus |
3L | 8638157..8638195 | 1177..1215 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8638267..8638656 | 1216..1605 | 99 | Plus | |
3L | 8626229..8626510 | 1..282 | 100 | -> | Plus |
3L | 8626961..8627109 | 283..431 | 100 | -> | Plus |
3L | 8627427..8627730 | 432..735 | 100 | -> | Plus |
3L | 8634583..8634783 | 736..936 | 100 | -> | Plus |
3L | 8635002..8635081 | 937..1016 | 100 | -> | Plus |
3L | 8637439..8637598 | 1017..1176 | 100 | -> | Plus |
3L | 8638157..8638195 | 1177..1215 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 8620527..8620830 | 432..735 | 100 | -> | Plus |
arm_3L | 8627683..8627883 | 736..936 | 100 | -> | Plus |
arm_3L | 8628102..8628181 | 937..1016 | 100 | -> | Plus |
arm_3L | 8630539..8630698 | 1017..1176 | 100 | -> | Plus |
arm_3L | 8631257..8631295 | 1177..1215 | 100 | -> | Plus |
arm_3L | 8631367..8631756 | 1216..1605 | 99 | Plus | |
arm_3L | 8619329..8619610 | 1..282 | 100 | -> | Plus |
arm_3L | 8620061..8620209 | 283..431 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8628102..8628181 | 937..1016 | 100 | -> | Plus |
3L | 8630539..8630698 | 1017..1176 | 100 | -> | Plus |
3L | 8631257..8631295 | 1177..1215 | 100 | -> | Plus |
3L | 8627683..8627883 | 736..936 | 100 | -> | Plus |
3L | 8619329..8619610 | 1..282 | 100 | -> | Plus |
3L | 8620061..8620209 | 283..431 | 100 | -> | Plus |
3L | 8620527..8620830 | 432..735 | 100 | -> | Plus |
3L | 8631367..8631756 | 1216..1605 | 99 | Plus |
Translation from 165 to 1301
> IP16036.pep MSPKLHEFAVVLLRDGQATPWGIRLVGGNDLDTPLIITRVQVGSPAHGEL LRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGAT QEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQT VFPQLNSSGGYEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLP GAKVKKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVG SEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYR AIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYN VVNTHDENIRQSGSFNRLMYSVIGATEY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24342-PA | 430 | GF24342-PA | 1..430 | 1..378 | 1829 | 83 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14334-PA | 429 | GG14334-PA | 1..429 | 1..378 | 1889 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22527-PA | 193 | GH22527-PA | 1..190 | 1..190 | 828 | 83.3 | Plus |
Dgri\GH15318-PA | 149 | GH15318-PA | 5..149 | 258..378 | 558 | 77.2 | Plus |
Dgri\GH22528-PA | 181 | GH22528-PA | 17..121 | 177..284 | 491 | 86.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Zasp66-PK | 378 | CG6416-PK | 1..378 | 1..378 | 1998 | 100 | Plus |
Zasp66-PF | 402 | CG6416-PF | 1..402 | 1..378 | 1963 | 94 | Plus |
Zasp66-PN | 406 | CG6416-PN | 68..406 | 40..378 | 1794 | 100 | Plus |
Zasp66-PE | 430 | CG6416-PE | 68..430 | 40..378 | 1759 | 93.4 | Plus |
Zasp66-PM | 322 | CG6416-PM | 1..321 | 1..321 | 1512 | 90 | Plus |
Zasp66-PB | 298 | CG6416-PB | 1..296 | 1..296 | 1509 | 97 | Plus |
Zasp66-PO | 326 | CG6416-PO | 68..324 | 40..296 | 1305 | 96.5 | Plus |
Zasp66-PI | 215 | CG6416-PI | 17..215 | 177..378 | 1010 | 95.5 | Plus |
Zasp66-PA | 239 | CG6416-PA | 17..239 | 177..378 | 975 | 85.4 | Plus |
Zasp66-PJ | 239 | CG6416-PJ | 17..239 | 177..378 | 975 | 85.4 | Plus |
Zasp66-PH | 135 | CG6416-PH | 17..133 | 177..296 | 521 | 85 | Plus |
Zasp66-PG | 165 | CG6416-PG | 17..121 | 177..284 | 513 | 91.7 | Plus |
Zasp67-PD | 604 | CG14168-PD | 14..163 | 20..149 | 158 | 32.7 | Plus |
Zasp67-PH | 682 | CG14168-PH | 14..163 | 20..149 | 158 | 32.7 | Plus |
Zasp67-PE | 725 | CG14168-PE | 14..163 | 20..149 | 158 | 32.7 | Plus |
Zasp67-PG | 730 | CG14168-PG | 14..163 | 20..149 | 158 | 32.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12917-PA | 429 | GI12917-PA | 1..429 | 1..378 | 1727 | 79.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10326-PA | 417 | GL10326-PA | 77..367 | 40..302 | 1178 | 78 | Plus |
Dper\GL10327-PA | 113 | GL10327-PA | 29..113 | 295..378 | 408 | 94.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19576-PA | 240 | GA19576-PA | 17..240 | 177..378 | 923 | 81.5 | Plus |
Dpse\GA28193-PA | 202 | GA28193-PA | 1..196 | 1..195 | 913 | 87.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25076-PA | 429 | GM25076-PA | 1..429 | 1..378 | 1912 | 87.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14114-PA | 231 | GD14114-PA | 1..200 | 1..200 | 1001 | 95.5 | Plus |
Dsim\GD14114-PA | 231 | GD14114-PA | 177..231 | 324..378 | 217 | 78.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13061-PA | 429 | GJ13061-PA | 1..429 | 1..378 | 1713 | 78.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16724-PA | 243 | GK16724-PA | 17..243 | 177..378 | 909 | 79.6 | Plus |
Dwil\GK16723-PA | 207 | GK16723-PA | 1..197 | 1..192 | 885 | 85.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20762-PA | 429 | GE20762-PA | 1..429 | 1..378 | 1902 | 86.7 | Plus |
Translation from 165 to 1301
> IP16036.hyp MSPKLHEFAVVLLRDGQATPWGIRLVGGNDLDTPLIITRVQVGSPAHGEL LRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGAT QEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQT VFPQLNSSGGYEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLP GAKVKKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVG SEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYR AIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYN VVNTHDENIRQSGSFNRLMYSVIGATEY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Zasp66-PK | 378 | CG6416-PK | 1..378 | 1..378 | 1998 | 100 | Plus |
Zasp66-PF | 402 | CG6416-PF | 1..402 | 1..378 | 1963 | 94 | Plus |
Zasp66-PN | 406 | CG6416-PN | 68..406 | 40..378 | 1794 | 100 | Plus |
Zasp66-PE | 430 | CG6416-PE | 68..430 | 40..378 | 1759 | 93.4 | Plus |
Zasp66-PM | 322 | CG6416-PM | 1..321 | 1..321 | 1512 | 90 | Plus |