Clone IP16043 Report

Search the DGRC for IP16043

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:160
Well:43
Vector:pOT2
Associated Gene/TranscriptCG6707-RA
Protein status:IP16043.pep: gold
Sequenced Size:1343

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6707 2008-04-29 Release 5.5 accounting
CG6707 2008-08-15 Release 5.9 accounting
CG6707 2008-12-18 5.12 accounting

Clone Sequence Records

IP16043.complete Sequence

1343 bp (1343 high quality bases) assembled on 2005-11-21

GenBank Submission: BT024243

> IP16043.complete
AGATCGCAGCGACTGCAGTGCATTTTCAACAAAAATAAGTTGAAATCAAC
GCGTTGCAGCAGCCCCCGCAGCAACAGCAACAACAAAACAAAGGCAACTG
GAAGTGCAGCCTAACGGGAATTGCTCCAGCATATAGAGATTATAGTCCAC
ACATATAAATATCCATTTATCGGAAGATAGTCCACAATGGCGGATCCAGA
GCGACAAAGCCTGATCAACAAGGACGACGGCAATGGCTACAATTCCGTGG
ACGCCGTGGACGAGGGTGCCGATAATCCCGGCAGCAACTCATCGGTGGCC
ACAAACGAGGACGGCAATGGAGCACCGACCGCAGTGCCTTGCATTGGACC
CGATGAGCTGCCGCCGCCGTATCAGCAGAGTACCAACACCGGAGGCGTCC
CGATGGTCACCTGTCGGGTATGTCAACACATGATTGACATCACCACGAAG
CGGGAGCAGCACGTGGTCAAGTGCACCCACTGCAATGAGGCTACTCCCAT
TCGGAACGCTCCAGCGGGCAAGAAGTATGTTCGCTGCCCATGCAACTGTT
TGTTAATCTGCAAGAGCTCGTCGCAGCGAATCGCTTGTCCAAGGCCCAAT
TGCAAGAGGATCATCAACCTGGCCCCAAGTCCCGTCACCCCGCCCGTGCC
AACCATGCCGGGCATGTGCCGCGTCACTTGTGGCCACTGTTCGGACACGT
TTTTGTTCAACACGTATCACAACGCCTTGGCCCGGTGTCCACACTGCAGG
AAGGTCTCATCGGTGGGCTCGCGCTTTGCCAACAGCCGCGCCGTGATGTT
CGCCATCGTGGCGCTGGTGTTCCTCATCACAGGCATCGCTGTAACTATCG
GCACATACTCGATTGCTTCGGATCATGGTGGCATGTACTTCCTCTACGTG
GCGCTGTTCGTGATTTCGGGTTGCATGCTGGCCAGGTCCGCCTACTATTT
CCGCCTTAAAGTGAGCGCCATCGATGGGCCAATGTAAAGCTAAAGCACGG
GGCCAGTAGCAAGGAAGAAAGTGCATTGTTTTATTTTTATATATATATAT
TATTCATATATATCATTCCTTTTGATATTAAATTTAAAACTAAACACAAG
CAGCCAATTTGCAGACGGAACATATGAACATTTCTCCAGCAGTTCAGCTA
CATACAAAAATTCTTCGTTTCGAGCAAAACTAATAGCAAACCTAGCTAAA
TTTACGAAAGAAGGTCTCCCCGTTGAAGAGCATAATTAGGATATTAAGGC
CGTAACTAACTAAACACTATACTAAAAGCGAATATTTCAAGGGTCGCCGT
GCAGCTACCATTCAAGTGCTAAAAGTAAAAAAAAAAAAAAAAA

IP16043.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG6707-RA 2083 CG6707-RA 126..1457 1..1332 6660 100 Plus
CG6707.b 2297 CG6707.b 377..1671 38..1332 6475 100 Plus
CG6707.a 2043 CG6707.a 151..1443 40..1332 6465 100 Plus
CG6707.b 2297 CG6707.b 76..115 1..40 200 100 Plus
CG6707.a 2043 CG6707.a 33..78 1..46 200 95.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:08:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9887224..9887680 1326..870 2285 100 Minus
chr3L 24539361 chr3L 9889732..9890008 314..38 1385 100 Minus
chr3L 24539361 chr3L 9887982..9888191 705..496 1035 99.5 Minus
chr3L 24539361 chr3L 9888257..9888439 495..313 915 100 Minus
chr3L 24539361 chr3L 9887760..9887926 871..705 835 100 Minus
chr3L 24539361 chr3L 9890320..9890365 46..1 200 95.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:26:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9895415..9895877 1332..870 2315 100 Minus
3L 28110227 3L 9897928..9898204 314..38 1385 100 Minus
3L 28110227 3L 9896179..9896388 705..496 1050 100 Minus
3L 28110227 3L 9896454..9896636 495..313 915 100 Minus
3L 28110227 3L 9895957..9896123 871..705 835 100 Minus
3L 28110227 3L 9898516..9898561 46..1 200 95.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:17:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9888515..9888977 1332..870 2315 100 Minus
3L 28103327 3L 9891028..9891304 314..38 1385 100 Minus
3L 28103327 3L 9889279..9889488 705..496 1050 100 Minus
3L 28103327 3L 9889554..9889736 495..313 915 100 Minus
3L 28103327 3L 9889057..9889223 871..705 835 100 Minus
3L 28103327 3L 9891616..9891661 46..1 200 95.6 Minus
Blast to na_te.dros performed 2019-03-15 22:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6769..6995 56..288 138 58 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6711..6798 40..131 135 64.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2363..2418 56..110 133 73.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6748..6819 56..131 127 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2400..2500 7..114 126 63 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6814..6970 6..161 126 60.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2315..2392 56..131 125 66.2 Plus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 7927..7993 39..104 125 67.2 Plus
TART-C 11124 TART-C TARTC 11124bp 9371..9437 39..104 125 67.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6748..6876 6..131 123 60.3 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3234..3342 1..110 123 61.6 Plus
roo 9092 roo DM_ROO 9092bp 1117..1162 56..100 119 76.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2348..2393 56..103 118 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2360..2434 6..88 117 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2369..2421 56..110 117 70.9 Plus
roo 9092 roo DM_ROO 9092bp 1084..1200 56..179 116 60.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1559..1599 56..96 115 75.6 Plus

IP16043.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:08:48 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9887224..9887679 871..1326 92 <- Minus
chr3L 9887761..9887925 706..870 100 <- Minus
chr3L 9887982..9888191 496..705 99 <- Minus
chr3L 9888257..9888438 314..495 100 <- Minus
chr3L 9889733..9890006 40..313 100 <- Minus
chr3L 9890327..9890365 1..39 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:01:43 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
CG6707-RC 1..801 187..987 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:45:51 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
CG6707-RC 1..801 187..987 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:10:23 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
CG6707-RA 1..801 187..987 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:27:22 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
CG6707-RC 1..801 187..987 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:13:37 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
CG6707-RA 1..801 187..987 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:19:09 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
CG6707-RA 33..1358 1..1326 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:45:51 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
CG6707-RA 33..1358 1..1326 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:10:23 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
CG6707-RA 15..1340 1..1326 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:27:22 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
CG6707-RA 33..1358 1..1326 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:13:37 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
CG6707-RA 15..1340 1..1326 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:48 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9895421..9895876 871..1326 100 <- Minus
3L 9895958..9896122 706..870 100 <- Minus
3L 9896179..9896388 496..705 100 <- Minus
3L 9896454..9896635 314..495 100 <- Minus
3L 9897929..9898202 40..313 100 <- Minus
3L 9898523..9898561 1..39 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:48 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9895421..9895876 871..1326 100 <- Minus
3L 9895958..9896122 706..870 100 <- Minus
3L 9896179..9896388 496..705 100 <- Minus
3L 9896454..9896635 314..495 100 <- Minus
3L 9897929..9898202 40..313 100 <- Minus
3L 9898523..9898561 1..39 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:48 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9895421..9895876 871..1326 100 <- Minus
3L 9895958..9896122 706..870 100 <- Minus
3L 9896179..9896388 496..705 100 <- Minus
3L 9896454..9896635 314..495 100 <- Minus
3L 9897929..9898202 40..313 100 <- Minus
3L 9898523..9898561 1..39 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:10:23 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9888521..9888976 871..1326 100 <- Minus
arm_3L 9889058..9889222 706..870 100 <- Minus
arm_3L 9889279..9889488 496..705 100 <- Minus
arm_3L 9889554..9889735 314..495 100 <- Minus
arm_3L 9891029..9891302 40..313 100 <- Minus
arm_3L 9891623..9891661 1..39 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:06:27 Download gff for IP16043.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9888521..9888976 871..1326 100 <- Minus
3L 9889058..9889222 706..870 100 <- Minus
3L 9889279..9889488 496..705 100 <- Minus
3L 9889554..9889735 314..495 100 <- Minus
3L 9891029..9891302 40..313 100 <- Minus
3L 9891623..9891661 1..39 100   Minus

IP16043.hyp Sequence

Translation from 186 to 986

> IP16043.hyp
MADPERQSLINKDDGNGYNSVDAVDEGADNPGSNSSVATNEDGNGAPTAV
PCIGPDELPPPYQQSTNTGGVPMVTCRVCQHMIDITTKREQHVVKCTHCN
EATPIRNAPAGKKYVRCPCNCLLICKSSSQRIACPRPNCKRIINLAPSPV
TPPVPTMPGMCRVTCGHCSDTFLFNTYHNALARCPHCRKVSSVGSRFANS
RAVMFAIVALVFLITGIAVTIGTYSIASDHGGMYFLYVALFVISGCMLAR
SAYYFRLKVSAIDGPM*

IP16043.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:16:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG6707-PC 266 CG6707-PC 1..266 1..266 1442 100 Plus
CG6707-PA 266 CG6707-PA 1..266 1..266 1442 100 Plus
CG6707-PB 231 CG6707-PB 8..231 43..266 1223 100 Plus

IP16043.pep Sequence

Translation from 186 to 986

> IP16043.pep
MADPERQSLINKDDGNGYNSVDAVDEGADNPGSNSSVATNEDGNGAPTAV
PCIGPDELPPPYQQSTNTGGVPMVTCRVCQHMIDITTKREQHVVKCTHCN
EATPIRNAPAGKKYVRCPCNCLLICKSSSQRIACPRPNCKRIINLAPSPV
TPPVPTMPGMCRVTCGHCSDTFLFNTYHNALARCPHCRKVSSVGSRFANS
RAVMFAIVALVFLITGIAVTIGTYSIASDHGGMYFLYVALFVISGCMLAR
SAYYFRLKVSAIDGPM*

IP16043.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23853-PA 268 GF23853-PA 1..268 1..266 1196 90.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13993-PA 266 GG13993-PA 1..266 1..266 1385 97.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15408-PA 263 GH15408-PA 1..263 1..266 1036 80.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG6707-PC 266 CG6707-PC 1..266 1..266 1442 100 Plus
CG6707-PA 266 CG6707-PA 1..266 1..266 1442 100 Plus
CG6707-PB 231 CG6707-PB 8..231 43..266 1223 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13013-PA 296 GI13013-PA 1..289 1..266 1030 74.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11872-PA 263 GL11872-PA 1..263 1..266 1175 89.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19800-PA 266 GA19800-PA 1..266 1..266 1193 89.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24829-PA 266 GM24829-PA 1..266 1..266 1404 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12881-PA 231 GD12881-PA 7..231 42..266 1183 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12105-PA 263 GJ12105-PA 1..263 1..266 1067 82.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17416-PA 268 GK17416-PA 1..268 1..266 1087 81.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20289-PA 266 GE20289-PA 1..266 1..266 1391 98.5 Plus