Clone IP16047 Report

Search the DGRC for IP16047

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:160
Well:47
Vector:pOT2
Associated Gene/TranscriptCG32495-RE
Protein status:IP16047.pep: gold
Sequenced Size:1325

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
GS 2008-04-29 Release 5.5 accounting
GS 2008-08-15 Release 5.9 accounting
GS 2008-12-18 5.12 accounting

Clone Sequence Records

IP16047.complete Sequence

1325 bp (1325 high quality bases) assembled on 2006-03-22

GenBank Submission: BT025054

> IP16047.complete
CCGGCGAGCAGACCCCGTGAGATACCGCGGCGAACAACTAACAACTAAGA
TACTCTGCCCCTTTTCTAGACGCAGCTGAGCCCCAGATCCCAGATCCCAG
ATACCAGCAGCAGACCGACCCAAGCAGAACGATCATGTCCAGCGACGCCA
ATACGGCCGTGCTGCGCAACTGCATCCGCTTGCCGCTGGCGGAGGATGAG
CTACTGGAGGTGACGGCCAAGGCCAAGGATTATGCCATTATGCACGGCGC
CGCCATGCGATCGAAGACGGCCTTCAGTCCGGACTCGTTGAATTTCGCCC
CCTTCGTGCTGGTGCCTTCCTCGTTTCCGCGCAAGGAGTTCGAAAAGGCG
GTGGCCCTACAGCCGATCATCAACCGGCTGATGCACAATGTGGCCCACGA
CGAGGAGTTCATCACGACGACGCTGGCGGAGACGATCAAAGTGGACGAGT
TCACGGCCAATCTGTTCAACATCTATCGCAAGGTGCTGGCGCACGGATTC
ACCCAGAAAACATCGCTGGGGATGCTGCGCAGCGATCTGATGCTGGAGTC
CGGCTGTCCCGAGCTGTCGCCACGGGCGCTGCGAACGGCGGCCGGTGAGG
ATCGTGGTCAGGATGCGGGCGCTGCTGTGGGGCAAATAGCTGGAGCTAAC
GGAGCTGCAGGAGTCGGAACTGCCGCTGGCACGGGCAGCAAGGAGGAGGA
GCACAGGGAGGTCCAGCTAAGCCGGGTCACCAAAGAGCCGGAACGGAGGG
CGACCGGCGCCCAGTCCGCTTACTGCTGCTGGAAGCAAGTCGAGATCAAT
ACGATAGCATCGGGCTTTGGCCACTTGGGACCAGCAAGTAAAACCATACA
AAGATTGTTGCCTAGAGTTTTCATTTGCTGACGCTGCTGTCGCCTGTCGC
CCGTTGCCTCCTGCCTGCCTGCTCTGCTCCTGCCTCCTGGCATCCTGCAT
CCTGCATCCTGGCACCTGCCAACCGACACCTGCTCCTCCCGACCCAACCG
TAGCATCTAACCCGCCCGCTAATAATCTTCACTTCCGTCAGTGATTGTCC
GTTCTGCTGTCGCTTACTCTACCAACTCTATAGTAGGTCAGGGGTTAGCC
AATATATATGCATATATATCTTTCTAGAAGATTTGAAGATAGCGATTTCA
CAAGATCTGATAAAGTGTTTGGATGATACATCACATCAATTTGTCATTTG
TAATCAGCAAAAGGCGCTAATCAAAAATTTCACCACTTGTACGCTTGGGC
TATTAAAACCCTAGAAGTTTCTGGAGGTTGAATTAAACAATTTAATTGTT
TGAAAGAAAAAAAAAAAAAAAAAAA

IP16047.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
GS-RG 1337 GS-RG 32..1337 1..1306 6515 99.9 Plus
CG32495-RE 1337 CG32495-RE 32..1337 1..1306 6515 99.9 Plus
CG32495.a 1486 CG32495.a 249..1486 69..1306 6175 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17781800..17782254 852..1306 2260 99.8 Plus
chrX 22417052 chrX 17791955..17792409 852..1306 2260 99.8 Plus
chrX 22417052 chrX 17780936..17781284 505..853 1745 100 Plus
chrX 22417052 chrX 17791091..17791439 505..853 1745 100 Plus
chrX 22417052 chrX 17779207..17779499 1..293 1465 100 Plus
chrX 22417052 chrX 17789362..17789654 1..293 1465 100 Plus
chrX 22417052 chrX 17789966..17790178 294..506 1065 100 Plus
chrX 22417052 chrX 17779811..17780023 294..506 1065 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:26:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17892450..17892910 852..1312 2275 99.6 Plus
X 23542271 X 17902605..17903065 852..1312 2275 99.6 Plus
X 23542271 X 17891586..17891934 505..853 1745 100 Plus
X 23542271 X 17901741..17902089 505..853 1745 100 Plus
X 23542271 X 17889857..17890149 1..293 1465 100 Plus
X 23542271 X 17900012..17900304 1..293 1465 100 Plus
X 23542271 X 17890461..17890673 294..506 1065 100 Plus
X 23542271 X 17900616..17900828 294..506 1065 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17910703..17911163 852..1312 2275 99.5 Plus
X 23527363 X 17900548..17901008 852..1312 2275 99.5 Plus
X 23527363 X 17909839..17910187 505..853 1745 100 Plus
X 23527363 X 17899684..17900032 505..853 1745 100 Plus
X 23527363 X 17908110..17908402 1..293 1465 100 Plus
X 23527363 X 17897955..17898247 1..293 1465 100 Plus
X 23527363 X 17898559..17898771 294..506 1065 100 Plus
X 23527363 X 17908714..17908926 294..506 1065 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:11:13 has no hits.

IP16047.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:12:06 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17779207..17779499 1..293 100 -> Plus
chrX 17779811..17780023 294..506 100 -> Plus
chrX 17780938..17781284 507..853 100 -> Plus
chrX 17781802..17782254 854..1306 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:01:48 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
GS-RC 1..722 135..856 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:58:15 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
GS-RG 1..747 135..881 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:11:06 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
GS-RG 1..747 135..881 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:39:00 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
GS-RC 1..722 135..856 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:14:17 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
CG32495-RE 1..747 135..881 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:38:22 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
GS-RD 32..887 1..856 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:58:15 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
GS-RG 32..1337 1..1306 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:11:06 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
GS-RG 32..1337 1..1306 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:39:00 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
GS-RD 32..887 1..856 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:14:17 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
CG32495-RE 32..1337 1..1306 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:12:06 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
X 17890461..17890673 294..506 100 -> Plus
X 17891588..17891934 507..853 100 -> Plus
X 17889857..17890149 1..293 100 -> Plus
X 17892452..17892904 854..1306 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:12:06 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
X 17890461..17890673 294..506 100 -> Plus
X 17891588..17891934 507..853 100 -> Plus
X 17889857..17890149 1..293 100 -> Plus
X 17892452..17892904 854..1306 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:12:06 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
X 17890461..17890673 294..506 100 -> Plus
X 17891588..17891934 507..853 100 -> Plus
X 17889857..17890149 1..293 100 -> Plus
X 17892452..17892904 854..1306 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:11:06 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17783890..17784182 1..293 100 -> Plus
arm_X 17784494..17784706 294..506 100 -> Plus
arm_X 17785621..17785967 507..853 100 -> Plus
arm_X 17786485..17786937 854..1306 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:17:42 Download gff for IP16047.complete
Subject Subject Range Query Range Percent Splice Strand
X 17897955..17898247 1..293 100 -> Plus
X 17898559..17898771 294..506 100 -> Plus
X 17899686..17900032 507..853 100 -> Plus
X 17900550..17901002 854..1306 99   Plus

IP16047.pep Sequence

Translation from 134 to 880

> IP16047.pep
MSSDANTAVLRNCIRLPLAEDELLEVTAKAKDYAIMHGAAMRSKTAFSPD
SLNFAPFVLVPSSFPRKEFEKAVALQPIINRLMHNVAHDEEFITTTLAET
IKVDEFTANLFNIYRKVLAHGFTQKTSLGMLRSDLMLESGCPELSPRALR
TAAGEDRGQDAGAAVGQIAGANGAAGVGTAAGTGSKEEEHREVQLSRVTK
EPERRATGAQSAYCCWKQVEINTIASGFGHLGPASKTIQRLLPRVFIC*

IP16047.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19360-PA 596 GF19360-PA 1..263 1..228 859 68.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:43:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19140-PA 561 GG19140-PA 1..240 1..242 1042 90.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:43:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24557-PA 539 GH24557-PA 1..219 1..238 712 64 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
Gss1-PG 248 CG6835-PG 1..248 1..248 1262 100 Plus
Gss2-PE 248 CG32495-PE 1..248 1..248 1262 100 Plus
Gss1-PI 562 CG6835-PI 1..242 1..242 1220 99.2 Plus
Gss1-PH 562 CG6835-PH 1..242 1..242 1220 99.2 Plus
Gss2-PH 562 CG32495-PH 1..242 1..242 1220 99.2 Plus
Gss2-PD 562 CG32495-PD 1..242 1..242 1220 99.2 Plus
Gss1-PJ 491 CG6835-PJ 1..143 1..141 663 93 Plus
Gss1-PE 491 CG6835-PE 1..143 1..141 663 93 Plus
Gss2-PG 491 CG32495-PG 1..143 1..141 663 93 Plus
Gss2-PB 491 CG32495-PB 1..143 1..141 663 93 Plus
Gss1-PK 127 CG6835-PK 1..124 1..124 626 100 Plus
Gss2-PI 127 CG32495-PI 1..124 1..124 626 100 Plus
Gss1-PF 134 CG6835-PF 1..124 1..124 626 100 Plus
Gss2-PF 134 CG32495-PF 1..124 1..124 626 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16238-PA 565 GI16238-PA 1..252 1..242 755 61.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16563-PA 89 GL16563-PA 1..86 1..86 388 86 Plus
Dper\GL16564-PA 486 GL16564-PA 1..120 130..237 221 55.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19893-PA 614 GA19893-PA 1..248 1..237 876 73.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:43:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22865-PA 631 GM22865-PA 1..245 1..240 980 86.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:43:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15929-PA 568 GJ15929-PA 1..250 1..244 745 59 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16117-PA 488 GK16117-PA 1..143 1..141 654 86 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:43:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17697-PA 491 GE17697-PA 1..143 1..141 695 92.3 Plus

IP16047.hyp Sequence

Translation from 134 to 880

> IP16047.hyp
MSSDANTAVLRNCIRLPLAEDELLEVTAKAKDYAIMHGAAMRSKTAFSPD
SLNFAPFVLVPSSFPRKEFEKAVALQPIINRLMHNVAHDEEFITTTLAET
IKVDEFTANLFNIYRKVLAHGFTQKTSLGMLRSDLMLESGCPELSPRALR
TAAGEDRGQDAGAAVGQIAGANGAAGVGTAAGTGSKEEEHREVQLSRVTK
EPERRATGAQSAYCCWKQVEINTIASGFGHLGPASKTIQRLLPRVFIC*

IP16047.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:16:41
Subject Length Description Subject Range Query Range Score Percent Strand
GS-PG 248 CG6835-PG 1..248 1..248 1262 100 Plus
CG32495-PE 248 CG32495-PE 1..248 1..248 1262 100 Plus
GS-PI 562 CG6835-PI 1..242 1..242 1220 99.2 Plus
GS-PH 562 CG6835-PH 1..242 1..242 1220 99.2 Plus
CG32495-PH 562 CG32495-PH 1..242 1..242 1220 99.2 Plus