Clone IP16115 Report

Search the DGRC for IP16115

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:161
Well:15
Vector:pOT2
Associated Gene/Transcriptsif-RH
Protein status:IP16115.pep: wuzgold
Sequenced Size:544

Clone Sequence Records

IP16115.complete Sequence

544 bp assembled on 2010-01-15

GenBank Submission: BT120133.1

> IP16115.complete
GATCTGCGGCAAGCTGCGCCAACTGCGCCATGGGTAACAAACTGAGCTGC
TCCTGTGCCCCGCTGATGCGCAAGGCCTATCGCTATGAGGATTCGCCCTG
GCAAAGTTCCCGTCGTCGCGATGGCCATCTATTGAGTTCGTTCAGGTTGT
GGGCAGAGGTCTTCCATGTATCAGCGAGCGGAGCCGGCACCGTCAAATGG
CAACAAGTGTCCGAGGATTTGGTTCCTGTTAACATCACCTGCATTCAGGA
CTCGCCCGAGTGCATCTTTCACATCACCGCGTACAACAGTCAGGTGGACA
AGATACTCGACGTGAGACTTGTGCAGCCAGGCACACGCATTGGCCAGGCA
TCGGAGTGTTTCGTTTACTGGAAGGATCCCATGACCAACGACACCTGGGG
CCTCAACTTCACCTCGCCCATCGATGCCAAGCAATTCCGCGAGTGCTGTG
TAAGTATTCTCTTACGGTCTGGCAAAGCAAACATTTTCGCATAGCGACGA
CAACAACAACCATGCCAAAACCCAAAAAAAAAAAAAAAAAAAAA

IP16115.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
sif-RH 687 sif-RH 124..656 1..533 2665 100 Plus
sif.j 8508 sif.j 124..573 1..450 2250 100 Plus
sif-RB 7857 sif-RB 124..572 1..449 2245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5661529..5661723 329..523 975 100 Plus
chr3L 24539361 chr3L 5661256..5661452 135..331 970 99.5 Plus
chr3L 24539361 chr3L 5660574..5660709 1..136 680 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:27:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5668962..5669166 329..533 1025 100 Plus
3L 28110227 3L 5668689..5668885 135..331 985 100 Plus
3L 28110227 3L 5668006..5668141 1..136 680 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5662062..5662266 329..533 1025 100 Plus
3L 28103327 3L 5661789..5661985 135..331 985 100 Plus
3L 28103327 3L 5661106..5661241 1..136 680 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:58:38 has no hits.

IP16115.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:59:37 Download gff for IP16115.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5661258..5661451 137..330 99 -> Plus
chr3L 5661531..5661723 331..523 100   Plus
chr3L 5660574..5660709 1..136 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-15 13:37:52 Download gff for IP16115.complete
Subject Subject Range Query Range Percent Splice Strand
sif-RH 1..465 30..494 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:52:45 Download gff for IP16115.complete
Subject Subject Range Query Range Percent Splice Strand
sif-RH 1..465 30..494 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:47:06 Download gff for IP16115.complete
Subject Subject Range Query Range Percent Splice Strand
sif-RM 1..421 30..450 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:27:16 Download gff for IP16115.complete
Subject Subject Range Query Range Percent Splice Strand
sif-RM 1..421 30..450 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-15 13:37:51 Download gff for IP16115.complete
Subject Subject Range Query Range Percent Splice Strand
sif-RH 124..646 1..523 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:52:45 Download gff for IP16115.complete
Subject Subject Range Query Range Percent Splice Strand
sif-RH 124..646 1..523 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:47:06 Download gff for IP16115.complete
Subject Subject Range Query Range Percent Splice Strand
sif-RM 1058..1507 1..450 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:27:16 Download gff for IP16115.complete
Subject Subject Range Query Range Percent Splice Strand
sif-RM 1058..1507 1..450 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:59:37 Download gff for IP16115.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5668006..5668141 1..136 100 -> Plus
3L 5668691..5668884 137..330 100 -> Plus
3L 5668964..5669156 331..523 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:59:37 Download gff for IP16115.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5668006..5668141 1..136 100 -> Plus
3L 5668691..5668884 137..330 100 -> Plus
3L 5668964..5669156 331..523 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:59:37 Download gff for IP16115.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5668006..5668141 1..136 100 -> Plus
3L 5668691..5668884 137..330 100 -> Plus
3L 5668964..5669156 331..523 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:47:06 Download gff for IP16115.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5661106..5661241 1..136 100 -> Plus
arm_3L 5661791..5661984 137..330 100 -> Plus
arm_3L 5662064..5662256 331..523 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:28:58 Download gff for IP16115.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5661106..5661241 1..136 100 -> Plus
3L 5661791..5661984 137..330 100 -> Plus
3L 5662064..5662256 331..523 100   Plus

IP16115.hyp Sequence

Translation from 2 to 493

> IP16115.hyp
SAASCANCAMGNKLSCSCAPLMRKAYRYEDSPWQSSRRRDGHLLSSFRLW
AEVFHVSASGAGTVKWQQVSEDLVPVNITCIQDSPECIFHITAYNSQVDK
ILDVRLVQPGTRIGQASECFVYWKDPMTNDTWGLNFTSPIDAKQFRECCV
SILLRSGKANIFA*

IP16115.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
sif-PM 2091 CG34418-PM 1..142 10..151 772 99.3 Plus
sif-PI 2072 CG34418-PI 1..151 10..160 770 94.7 Plus
sif-PB 2072 CG34418-PB 1..151 10..160 770 94.7 Plus
sif-PN 2081 CG34418-PN 1..151 10..160 770 94.7 Plus
sif-PF 2657 CG34418-PF 1..151 10..160 770 94.7 Plus

IP16115.pep Sequence

Translation from 2 to 493

> IP16115.pep
SAASCANCAMGNKLSCSCAPLMRKAYRYEDSPWQSSRRRDGHLLSSFRLW
AEVFHVSASGAGTVKWQQVSEDLVPVNITCIQDSPECIFHITAYNSQVDK
ILDVRLVQPGTRIGQASECFVYWKDPMTNDTWGLNFTSPIDAKQFRECCV
SILLRSGKANIFA*

IP16115.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:27:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23987-PA 809 GF23987-PA 1..150 10..159 791 95.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:27:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15281-PA 802 GG15281-PA 1..150 10..159 791 95.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16464-PA 2078 GH16464-PA 1..151 10..160 792 94.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
sif-PM 2091 CG34418-PM 1..142 10..151 772 99.3 Plus
sif-PI 2072 CG34418-PI 1..151 10..160 770 94.7 Plus
sif-PB 2072 CG34418-PB 1..151 10..160 770 94.7 Plus
sif-PN 2081 CG34418-PN 1..151 10..160 770 94.7 Plus
sif-PF 2657 CG34418-PF 1..151 10..160 770 94.7 Plus
sif-PQ 2676 CG34418-PQ 1..151 10..160 770 94.7 Plus
sif-PJ 2734 CG34418-PJ 1..151 10..160 770 94.7 Plus
sif-PO 2088 CG34418-PO 1..139 10..151 744 97.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12138-PA 3153 GI12138-PA 1..137 10..149 765 97.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12338-PA 2331 GL12338-PA 1..151 10..160 790 94.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23470-PA 825 GA23470-PA 1..150 10..159 792 95.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14715-PA 924 GM14715-PA 1..119 10..128 667 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13896-PA 2022 GD13896-PA 1..151 10..160 792 94.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13414-PA 813 GJ13414-PA 1..150 10..159 791 95.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17304-PA 2324 GK17304-PA 1..150 10..159 793 95.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21503-PA 804 GE21503-PA 1..150 10..159 791 95.3 Plus