BDGP Sequence Production Resources |
Search the DGRC for IP16115
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 161 |
Well: | 15 |
Vector: | pOT2 |
Associated Gene/Transcript | sif-RH |
Protein status: | IP16115.pep: wuzgold |
Sequenced Size: | 544 |
544 bp assembled on 2010-01-15
GenBank Submission: BT120133.1
> IP16115.complete GATCTGCGGCAAGCTGCGCCAACTGCGCCATGGGTAACAAACTGAGCTGC TCCTGTGCCCCGCTGATGCGCAAGGCCTATCGCTATGAGGATTCGCCCTG GCAAAGTTCCCGTCGTCGCGATGGCCATCTATTGAGTTCGTTCAGGTTGT GGGCAGAGGTCTTCCATGTATCAGCGAGCGGAGCCGGCACCGTCAAATGG CAACAAGTGTCCGAGGATTTGGTTCCTGTTAACATCACCTGCATTCAGGA CTCGCCCGAGTGCATCTTTCACATCACCGCGTACAACAGTCAGGTGGACA AGATACTCGACGTGAGACTTGTGCAGCCAGGCACACGCATTGGCCAGGCA TCGGAGTGTTTCGTTTACTGGAAGGATCCCATGACCAACGACACCTGGGG CCTCAACTTCACCTCGCCCATCGATGCCAAGCAATTCCGCGAGTGCTGTG TAAGTATTCTCTTACGGTCTGGCAAAGCAAACATTTTCGCATAGCGACGA CAACAACAACCATGCCAAAACCCAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 5661529..5661723 | 329..523 | 975 | 100 | Plus |
chr3L | 24539361 | chr3L | 5661256..5661452 | 135..331 | 970 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 5660574..5660709 | 1..136 | 680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 5661258..5661451 | 137..330 | 99 | -> | Plus |
chr3L | 5661531..5661723 | 331..523 | 100 | Plus | |
chr3L | 5660574..5660709 | 1..136 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
sif-RH | 1..465 | 30..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
sif-RH | 1..465 | 30..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
sif-RM | 1..421 | 30..450 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
sif-RM | 1..421 | 30..450 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
sif-RH | 124..646 | 1..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
sif-RH | 124..646 | 1..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
sif-RM | 1058..1507 | 1..450 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
sif-RM | 1058..1507 | 1..450 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5668006..5668141 | 1..136 | 100 | -> | Plus |
3L | 5668691..5668884 | 137..330 | 100 | -> | Plus |
3L | 5668964..5669156 | 331..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5668006..5668141 | 1..136 | 100 | -> | Plus |
3L | 5668691..5668884 | 137..330 | 100 | -> | Plus |
3L | 5668964..5669156 | 331..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5668006..5668141 | 1..136 | 100 | -> | Plus |
3L | 5668691..5668884 | 137..330 | 100 | -> | Plus |
3L | 5668964..5669156 | 331..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 5661106..5661241 | 1..136 | 100 | -> | Plus |
arm_3L | 5661791..5661984 | 137..330 | 100 | -> | Plus |
arm_3L | 5662064..5662256 | 331..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5661106..5661241 | 1..136 | 100 | -> | Plus |
3L | 5661791..5661984 | 137..330 | 100 | -> | Plus |
3L | 5662064..5662256 | 331..523 | 100 | Plus |
Translation from 2 to 493
> IP16115.hyp SAASCANCAMGNKLSCSCAPLMRKAYRYEDSPWQSSRRRDGHLLSSFRLW AEVFHVSASGAGTVKWQQVSEDLVPVNITCIQDSPECIFHITAYNSQVDK ILDVRLVQPGTRIGQASECFVYWKDPMTNDTWGLNFTSPIDAKQFRECCV SILLRSGKANIFA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
sif-PM | 2091 | CG34418-PM | 1..142 | 10..151 | 772 | 99.3 | Plus |
sif-PI | 2072 | CG34418-PI | 1..151 | 10..160 | 770 | 94.7 | Plus |
sif-PB | 2072 | CG34418-PB | 1..151 | 10..160 | 770 | 94.7 | Plus |
sif-PN | 2081 | CG34418-PN | 1..151 | 10..160 | 770 | 94.7 | Plus |
sif-PF | 2657 | CG34418-PF | 1..151 | 10..160 | 770 | 94.7 | Plus |
Translation from 2 to 493
> IP16115.pep SAASCANCAMGNKLSCSCAPLMRKAYRYEDSPWQSSRRRDGHLLSSFRLW AEVFHVSASGAGTVKWQQVSEDLVPVNITCIQDSPECIFHITAYNSQVDK ILDVRLVQPGTRIGQASECFVYWKDPMTNDTWGLNFTSPIDAKQFRECCV SILLRSGKANIFA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23987-PA | 809 | GF23987-PA | 1..150 | 10..159 | 791 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15281-PA | 802 | GG15281-PA | 1..150 | 10..159 | 791 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16464-PA | 2078 | GH16464-PA | 1..151 | 10..160 | 792 | 94.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
sif-PM | 2091 | CG34418-PM | 1..142 | 10..151 | 772 | 99.3 | Plus |
sif-PI | 2072 | CG34418-PI | 1..151 | 10..160 | 770 | 94.7 | Plus |
sif-PB | 2072 | CG34418-PB | 1..151 | 10..160 | 770 | 94.7 | Plus |
sif-PN | 2081 | CG34418-PN | 1..151 | 10..160 | 770 | 94.7 | Plus |
sif-PF | 2657 | CG34418-PF | 1..151 | 10..160 | 770 | 94.7 | Plus |
sif-PQ | 2676 | CG34418-PQ | 1..151 | 10..160 | 770 | 94.7 | Plus |
sif-PJ | 2734 | CG34418-PJ | 1..151 | 10..160 | 770 | 94.7 | Plus |
sif-PO | 2088 | CG34418-PO | 1..139 | 10..151 | 744 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12138-PA | 3153 | GI12138-PA | 1..137 | 10..149 | 765 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12338-PA | 2331 | GL12338-PA | 1..151 | 10..160 | 790 | 94.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23470-PA | 825 | GA23470-PA | 1..150 | 10..159 | 792 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14715-PA | 924 | GM14715-PA | 1..119 | 10..128 | 667 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13896-PA | 2022 | GD13896-PA | 1..151 | 10..160 | 792 | 94.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13414-PA | 813 | GJ13414-PA | 1..150 | 10..159 | 791 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17304-PA | 2324 | GK17304-PA | 1..150 | 10..159 | 793 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21503-PA | 804 | GE21503-PA | 1..150 | 10..159 | 791 | 95.3 | Plus |