Clone IP16165 Report

Search the DGRC for IP16165

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:161
Well:65
Vector:pOT2
Associated Gene/TranscriptAcp63F-RA
Protein status:IP16165.pep: gold
Sequenced Size:328

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Acp63F 2008-12-18 5.12 accounting

Clone Sequence Records

IP16165.complete Sequence

328 bp assembled on 2008-12-10

GenBank Submission: BT053707.1

> IP16165.complete
GATGAAAGCTATCATCGTTTTTATTCTGTTCATTTCAAGTGTGCATGCTA
TGAGCAAATGCAACCAAGCAATTTATCTAAATCTTGATCCTCACTGCGGA
ATACTTCCCGATTGTAACTTAGATGGTCCAAATCCAAGTTACCTCAAAAG
GGTGTCGTGTGAACGCAAAGAAAACGGAAAACCAGGATTCATCGAACTAA
TTCCCGGAAAATGTCTCCATGGTAAACCGCGTTGCTCGTTAAAATAGTAA
TATTGTTCCAATATTTCCATGCATATATGTTTCAATTAAAGGCATTATAA
ATACCTATAAAAAAAAAAAAAAAAAAAA

IP16165.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
Acp63F-RA 452 Acp63F-RA 60..368 1..309 1545 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3815541..3815697 186..30 770 99.4 Minus
chr3L 24539361 chr3L 3815364..3815488 308..184 625 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:27:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3816100..3816256 186..30 785 100 Minus
3L 28110227 3L 3815923..3816048 309..184 630 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3816100..3816256 186..30 785 100 Minus
3L 28103327 3L 3815923..3816048 309..184 630 100 Minus
3L 28103327 3L 3816318..3816346 29..1 145 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:34:29 has no hits.

IP16165.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:35:05 Download gff for IP16165.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3815364..3815486 186..308 100 <- Minus
chr3L 3815542..3815697 30..185 99 <- Minus
chr3L 3815760..3815788 1..29 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:06 Download gff for IP16165.complete
Subject Subject Range Query Range Percent Splice Strand
Acp63F-RA 1..246 2..247 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:10 Download gff for IP16165.complete
Subject Subject Range Query Range Percent Splice Strand
Acp63F-RA 1..246 2..247 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:36:44 Download gff for IP16165.complete
Subject Subject Range Query Range Percent Splice Strand
Acp63F-RA 1..246 2..247 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:33:32 Download gff for IP16165.complete
Subject Subject Range Query Range Percent Splice Strand
Acp63F-RA 1..246 2..247 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-10 17:57:30 Download gff for IP16165.complete
Subject Subject Range Query Range Percent Splice Strand
Acp63F-RA 9..316 1..308 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:10 Download gff for IP16165.complete
Subject Subject Range Query Range Percent Splice Strand
Acp63F-RA 9..316 1..308 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:36:44 Download gff for IP16165.complete
Subject Subject Range Query Range Percent Splice Strand
Acp63F-RA 9..316 1..308 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:33:32 Download gff for IP16165.complete
Subject Subject Range Query Range Percent Splice Strand
Acp63F-RA 9..316 1..308 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:35:05 Download gff for IP16165.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3815924..3816046 186..308 100 <- Minus
3L 3816101..3816256 30..185 100 <- Minus
3L 3816318..3816346 1..29 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:35:05 Download gff for IP16165.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3815924..3816046 186..308 100 <- Minus
3L 3816101..3816256 30..185 100 <- Minus
3L 3816318..3816346 1..29 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:35:05 Download gff for IP16165.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3815924..3816046 186..308 100 <- Minus
3L 3816101..3816256 30..185 100 <- Minus
3L 3816318..3816346 1..29 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:36:44 Download gff for IP16165.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3815924..3816046 186..308 100 <- Minus
arm_3L 3816101..3816256 30..185 100 <- Minus
arm_3L 3816318..3816346 1..29 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:52 Download gff for IP16165.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3815924..3816046 186..308 100 <- Minus
3L 3816101..3816256 30..185 100 <- Minus
3L 3816318..3816346 1..29 100   Minus

IP16165.hyp Sequence

Translation from 0 to 246

> IP16165.hyp
MKAIIVFILFISSVHAMSKCNQAIYLNLDPHCGILPDCNLDGPNPSYLKR
VSCERKENGKPGFIELIPGKCLHGKPRCSLK*

IP16165.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
Acp63F-PB 81 CG10852-PB 1..81 1..81 444 100 Plus
Acp63F-PA 81 CG10852-PA 1..81 1..81 444 100 Plus

IP16165.pep Sequence

Translation from 1 to 246

> IP16165.pep
MKAIIVFILFISSVHAMSKCNQAIYLNLDPHCGILPDCNLDGPNPSYLKR
VSCERKENGKPGFIELIPGKCLHGKPRCSLK*

IP16165.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
Acp63F-PB 81 CG10852-PB 1..81 1..81 444 100 Plus
Acp63F-PA 81 CG10852-PA 1..81 1..81 444 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14036-PA 81 GM14036-PA 1..81 1..81 318 72.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Acp63F-PA 81 GD13315-PA 1..81 1..81 300 69.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20672-PA 82 GE20672-PA 1..78 1..78 206 47.4 Plus