IP16165.complete Sequence
328 bp assembled on 2008-12-10
GenBank Submission: BT053707.1
> IP16165.complete
GATGAAAGCTATCATCGTTTTTATTCTGTTCATTTCAAGTGTGCATGCTA
TGAGCAAATGCAACCAAGCAATTTATCTAAATCTTGATCCTCACTGCGGA
ATACTTCCCGATTGTAACTTAGATGGTCCAAATCCAAGTTACCTCAAAAG
GGTGTCGTGTGAACGCAAAGAAAACGGAAAACCAGGATTCATCGAACTAA
TTCCCGGAAAATGTCTCCATGGTAAACCGCGTTGCTCGTTAAAATAGTAA
TATTGTTCCAATATTTCCATGCATATATGTTTCAATTAAAGGCATTATAA
ATACCTATAAAAAAAAAAAAAAAAAAAA
IP16165.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:15:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp63F-RA | 452 | Acp63F-RA | 60..368 | 1..309 | 1545 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:34:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 3815541..3815697 | 186..30 | 770 | 99.4 | Minus |
chr3L | 24539361 | chr3L | 3815364..3815488 | 308..184 | 625 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:27:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:34:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3816100..3816256 | 186..30 | 785 | 100 | Minus |
3L | 28110227 | 3L | 3815923..3816048 | 309..184 | 630 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 3816100..3816256 | 186..30 | 785 | 100 | Minus |
3L | 28103327 | 3L | 3815923..3816048 | 309..184 | 630 | 100 | Minus |
3L | 28103327 | 3L | 3816318..3816346 | 29..1 | 145 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 14:34:29 has no hits.
IP16165.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:35:05 Download gff for
IP16165.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 3815364..3815486 | 186..308 | 100 | <- | Minus |
chr3L | 3815542..3815697 | 30..185 | 99 | <- | Minus |
chr3L | 3815760..3815788 | 1..29 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:06 Download gff for
IP16165.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp63F-RA | 1..246 | 2..247 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:10 Download gff for
IP16165.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp63F-RA | 1..246 | 2..247 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:36:44 Download gff for
IP16165.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp63F-RA | 1..246 | 2..247 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:33:32 Download gff for
IP16165.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp63F-RA | 1..246 | 2..247 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-10 17:57:30 Download gff for
IP16165.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp63F-RA | 9..316 | 1..308 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:10 Download gff for
IP16165.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp63F-RA | 9..316 | 1..308 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:36:44 Download gff for
IP16165.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp63F-RA | 9..316 | 1..308 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:33:32 Download gff for
IP16165.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp63F-RA | 9..316 | 1..308 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:35:05 Download gff for
IP16165.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3815924..3816046 | 186..308 | 100 | <- | Minus |
3L | 3816101..3816256 | 30..185 | 100 | <- | Minus |
3L | 3816318..3816346 | 1..29 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:35:05 Download gff for
IP16165.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3815924..3816046 | 186..308 | 100 | <- | Minus |
3L | 3816101..3816256 | 30..185 | 100 | <- | Minus |
3L | 3816318..3816346 | 1..29 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:35:05 Download gff for
IP16165.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3815924..3816046 | 186..308 | 100 | <- | Minus |
3L | 3816101..3816256 | 30..185 | 100 | <- | Minus |
3L | 3816318..3816346 | 1..29 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:36:44 Download gff for
IP16165.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3815924..3816046 | 186..308 | 100 | <- | Minus |
arm_3L | 3816101..3816256 | 30..185 | 100 | <- | Minus |
arm_3L | 3816318..3816346 | 1..29 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:52 Download gff for
IP16165.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3815924..3816046 | 186..308 | 100 | <- | Minus |
3L | 3816101..3816256 | 30..185 | 100 | <- | Minus |
3L | 3816318..3816346 | 1..29 | 100 | | Minus |
IP16165.hyp Sequence
Translation from 0 to 246
> IP16165.hyp
MKAIIVFILFISSVHAMSKCNQAIYLNLDPHCGILPDCNLDGPNPSYLKR
VSCERKENGKPGFIELIPGKCLHGKPRCSLK*
IP16165.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:19:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp63F-PB | 81 | CG10852-PB | 1..81 | 1..81 | 444 | 100 | Plus |
Acp63F-PA | 81 | CG10852-PA | 1..81 | 1..81 | 444 | 100 | Plus |
IP16165.pep Sequence
Translation from 1 to 246
> IP16165.pep
MKAIIVFILFISSVHAMSKCNQAIYLNLDPHCGILPDCNLDGPNPSYLKR
VSCERKENGKPGFIELIPGKCLHGKPRCSLK*
IP16165.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp63F-PB | 81 | CG10852-PB | 1..81 | 1..81 | 444 | 100 | Plus |
Acp63F-PA | 81 | CG10852-PA | 1..81 | 1..81 | 444 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:28:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14036-PA | 81 | GM14036-PA | 1..81 | 1..81 | 318 | 72.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:28:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\Acp63F-PA | 81 | GD13315-PA | 1..81 | 1..81 | 300 | 69.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:28:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE20672-PA | 82 | GE20672-PA | 1..78 | 1..78 | 206 | 47.4 | Plus |